KEGG   Rattus norvegicus (rat): 171381
Entry
171381            CDS       T01003                                 

Gene name
Psd, EFA6
Definition
(RefSeq) pleckstrin and Sec7 domain containing
  KO
K12494  PH and SEC7 domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    171381 (Psd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171381 (Psd)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    171381 (Psd)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    171381 (Psd)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   171381 (Psd)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 171381
NCBI-ProteinID: NP_599197
RGD: 620297
Ensembl: ENSRNOG00000019435
UniProt: G3V8J5
Position
1q54
AA seq 1023 aa
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLIRRVVGPGPRGRDL
GRVTAPCTPLRAPPSPHIAPSPWGPSSPTGKPPPGAQSSVVIFRFVEKASVRPLNGLPAS
GGLSRSWDLGGISPSRPTPALGPGCNRKLRLEASTSDPLPAGGGSVLPGSRDPSRGPLIP
PQIGADGLYSSLPNGLGGTPEHLVMHFRGPADTGFLNQGDTWSSREVSSHAQRIARAKWE
FFYGSLDPPSSGAKPPEQALPSHGVGSKQGSGVAVGRAAKYSETDLDKVPLRCYRETDID
EVLAEREEADSAIESQPSSEGPPGTTQPPASRPSPCPGPSSSLGSGNGDDEAGGEEDVDD
EVFEASEGARPGDHMPHSGLLKSPVPFLPGTSPSADGPDSFSCMFEAIMESHRAKGTSYS
SLASLEALASPGPTQSPFFTFEMPPQPPAPRPDPPAPAPLAPLEPDSGTSSVADGPWTQR
REVEESDAGATLAPRKELPSPSHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLAL
GSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFT
GMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLN
TDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSL
SELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKR
GWKSFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRASDYSKRPHVFYLRT
ADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQE
EQVRTHEAKLKAMASELREHRAAHLGKKARGKEAEEQRQKETYLEFEKSRYGTYAALLRV
KMKAASEELDAIEAALAQAGSTEEGCPPPHSSPSLQPNPTSQPRAQRPGSEARAGAGSTR
PKP
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggcccagggtgccatgcggttctgctcagaaggcgactgtgccatctccccaccacga
tgccctcgtcgctggctcccggaaggcccagtgccccaaagtcccccagccagcatgtat
ggcagcacaggatccctaatacgacgagtggtgggcccaggtcctcgaggccgggatctg
ggacgtgtgacagcaccttgtacccctctgcgagcccctccctcaccccatatagctccc
tcaccctggggaccctcttcacccactgggaagcccccaccaggggcacagagttctgtg
gtcatcttccgtttcgtggagaaggccagtgtgaggccactgaatggcctacctgcttct
ggaggcctgagtcggagctgggacctgggtgggatttctccctccaggcccaccccagcc
cttggacctggctgcaaccggaagttgcggctagaagcgtccacatcagacccactccca
gccggaggaggctccgttcttcctggcagcagggacccctcacgtgggccattgatccca
ccccagattggggcagatggcctttactcctctctccccaatgggctgggggggacccct
gagcacttggtcatgcacttccgaggacctgcagacaccggatttctaaaccagggggac
acctggtcctcccgggaagtctcctctcatgcccagagaatcgctcgagccaagtgggaa
ttcttctatggctccttggacccccccagctcaggtgctaagcccccagagcaggccctc
ccatcacatggggtgggctccaagcaaggctctggggtagctgtggggcgagcagccaag
tactccgagacagacctggacaaggtacccctgaggtgctaccgagagactgacattgac
gaggtgctggctgagcgggaggaggctgactccgccattgagagtcagcccagctctgag
ggcccccctggcactacccaaccacctgcctcacgacccagcccatgccctggtccttct
tccagtctgggcagtggtaacggagatgatgaggcaggtggtgaagaggacgtggatgat
gaggtgtttgaggcctcagagggggcccggccaggggaccacatgcctcactctgggctc
ctcaagtcaccagtcccctttctaccggggaccagcccctcagcggatgggcctgactct
ttcagttgtatgtttgaagccatcatggagtcgcaccgggccaagggcacctcctatagt
agccttgcctccctggaagctctggcctcacctggcccaacccagagtcccttcttcacc
tttgagatgcctccccaacccccagctccccggcctgacccacctgcacctgccccactt
gcccctcttgaaccggattctggtaccagctctgttgctgatggtccttggacccaaagg
agagaggtagaagagtcagatgctggggctacgctggccccaaggaaagagcttcctagt
ccctcccactctgaggacagccttgggctgggggcagcacccctgggcagtgaaccgccc
ctgagccaactggtgtccgactcagactcagagctggacagcacagagcggctggccctg
ggaagcacagacaccttgtccaatggacagaaagcagatctggaggctgcacagcgccta
gccaagaggctataccgacttgatggcttcaggaaggccgacgtagcccggcatctgggc
aagaacaatgacttcagcaaattggtggctggcgagtatctcaagttttttgtcttcacg
ggcatgaccctggatcaagctctcagggtgtttctaaaggagctggctttaatgggtgag
acccaggagcgggagcgtgtactggcccacttctcccagcgatatttccagtgtaatcct
gaagccctgtcctcagaggacggcgctcacacgctgacctgtgctctcatgctcctcaac
acggacctccacggccacaacattgggaagcgaatgacctgtggggacttcatcggaaac
ctggagggcctcaatgatggcggcgacttccccagggagctgctcaaggccttgtacagc
tccatcaagaatgaaaagttgcaatgggccatagacgaggaggaacttcggcgatctctg
tccgagttggccgaccctaaccccaaggtcatcaagagggtcagcggaggcagcggcagc
agctccagccccttcctggacctgactcccgagcctggggcagctgtctacaagcacggg
gccctggtgcgaaaggtgcacgcagaccctgactgcaggaagacacctcgtggcaagcgg
ggctggaagagcttccacgggatcctcaagggcatgatcctctacctgcagaaggaggag
taccagcccgggaaggctctttccgaggcagagctgaagaacgccattagcattcaccac
gctctggccacccgcgccagcgactacagcaagagaccacacgtcttctacctgcgcaca
gccgactggagggtcttcctcttccaggccccgagcctggagcaaatgcagtcctggatt
actcgcatcaatgtggtggctgccatgttttctgcaccccccttcccagctgctgtcagt
tcccagaagaaattcagccgtcctctgctgcccagcgctgccacccgcctctcccaggag
gagcaggtgaggactcacgaggccaagctgaaggccatggcaagcgagcttcgagagcac
cgggcagcacatctggggaagaaggcccgaggcaaggaggctgaggagcagaggcagaag
gagacctacctggagtttgagaaatcccgctatggcacctacgcggcgctgcttcgagtc
aagatgaaggccgccagcgaggagctggatgccatagaggcagcactggcccaggctggg
agcacggaggaaggatgccctccgcctcactccagtccttccctgcagcccaaccccacc
agccagccccgggctcagcgtcctggctcagaagcccgggccggggcaggcagtacaagg
ccaaagccctga

DBGET integrated database retrieval system