KEGG   Rattus norvegicus (rat): 171384Help
Entry
171384            CDS       T01003                                 

Gene name
Trpm8, CMR1
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 8
  KO
K04983  transient receptor potential cation channel subfamily M member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    171384 (Trpm8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    171384 (Trpm8)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   171384 (Trpm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk LSDAT_prok
Motif
Other DBs
NCBI-GeneID: 171384
NCBI-ProteinID: NP_599198
RGD: 620762
Ensembl: ENSRNOG00000019035
UniProt: Q8R455
Position
9q35
AA seq 1104 aa AA seqDB search
MSFEGARLSMRSRRNGTLGSTRTLYSSVSRSTDVSYSESDLVNFIQANFKKRECVFFTRD
SKAMESICKCGYAQSQHIEGTQINQNEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYLRL
SCDTDSETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSNRDTLIRNCDDEGHFSAQY
IMDDFMRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTSQDSNYGGKIP
IVCFAQGGGRETLKAINTSVKSKIPCVVVEGSGQIADVIASLVEVEDVLTSSMVKEKLVR
FLPRTVSRLPEEEIESWIKWLKEILESPHLLTVIKMEEAGDEVVSSAISYALYKAFSTNE
QDKDNWNGQLKLLLEWNQLDLASDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLQKFLTNEVLTELFSTHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRSFWKEDR
SSREDLDVELHDASLTTRHPLQALFIWAILQNKKELSKVIWEQTKGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGLVSFRKKPIDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHTPELILYALVFVLFC
DEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEYNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAY
FYMVVKKCFKCCCKEKNTESSACCFRNEDNETLAWEGVMKENYLVKINTKANDNAEEMRH
RFRQLDTKLNDLKGLLKEIANKIK
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgagggagccaggctcagcatgaggagccgcagaaatggaactctgggcagc
acccggaccctgtactccagcgtgtctcggagcacagacgtgtcctacagtgaaagtgat
ttggtgaattttattcaggcaaattttaaaaaacgagaatgcgtcttctttaccagagac
tccaaggccatggagagcatatgcaagtgtggttatgcccagagccagcatatcgaaggc
acccagatcaaccaaaatgagaagtggaactacaaaaaacacaccaaggagtttccaaca
gacgcctttggggacattcagtttgagactctggggaagaaaggcaagtacttacgctta
tcctgtgacacggactctgaaaccctctacgaactgctgacccagcactggcacctcaaa
acacccaacctggtcatctcagtgacgggtggagccaaaaactttgctttgaagccacgc
atgcgcaaaatcttcagtcggctgatctacatcgctcagtctaaaggggcatggattctt
accggaggcactcattacggtctgatgaagtacataggtgaagtggtgagggataacacc
atcagcaggaactcggaagagaacatcgtggccattggcatagcggcctggggcatggtc
tccaacagggacaccctcatcaggaattgtgatgatgagggacatttttcagctcaatat
atcatggatgacttcatgagagatcctctctacatcctggacaacaatcatacccacctg
ctgcttgtggacaacggttgtcatggacaccccacggtggaagccaaacttcggaatcag
ctggagaagtacatctctgagcgcaccagtcaagattccaactatggtggtaagatcccc
atcgtgtgttttgcccagggaggtggaagagaaactttgaaagccatcaacacctctgtc
aaaagtaagatcccctgtgtggtggtggaaggctcggggcagattgccgatgtgattgcc
agcctggtggaggtagaggatgttttaacctcttccatggtcaaagagaagctggtacgg
tttttaccccgcactgtgtcccggctgcctgaagaggagattgagagctggatcaaatgg
ctcaaagaaattcttgagagcccccacctcctcacggtcatcaagatggaggaggctgga
gacgaggtcgtgagcagcgccatttcctacgcgctgtacaaagccttcagcactaatgaa
caagacaaggacaactggaacggacagctgaagcttctgctggagtggaaccaactggac
cttgccagtgatgagatcttcaccaatgaccgccgctgggagtctgccgaccttcaggaa
gtcatgttcacggccctcataaaggacaggcccaagtttgtccgcctcttcctggagaat
ggcctcaacctgcagaagttcctcaccaatgaagtcctcacggagctcttctccacccac
ttcagcaccctagtgtaccggaacctgcagatcgccaagaactcctacaacgatgcactc
cttacctttgtctggaagttggtggcaaacttccgtagaagcttctggaaagaggacaga
agcagcagggaggacttggatgtggaactccatgatgcatctctcaccacccggcacccc
ctgcaggctcttttcatctgggccattcttcagaacaagaaggaactctccaaggtcatc
tgggagcaaaccaaaggctgtactctggccgccttgggggccagcaaacttctgaagacc
ctggccaaagttaagaatgatatcaacgcagctggggaatctgaggaactggctaatgag
tatgagacccgagcagtggagttgttcactgagtgttacagcagtgatgaggacttggca
gaacagctactggtctactcttgtgaagcctggggtgggagcaactgtctggagctggcg
gtggaggctacggaccagcatttcattgctcagcctggggtccagaatttcctttctaag
caatggtatggagagatttcccgagacacgaagaactggaagattatcctgtgtctgttc
atcatccccctggtgggctgtggcctcgtatcgtttaggaagaagcccattgacaagcac
aagaagctgctctggtactacgtggccttcttcacttcgcccttcgtggtcttctcctgg
aacgtggtcttctacatcgccttcctcctgctgtttgcgtatgtgctgctcatggacttc
cactcggtgccacacacccccgagctgatcctctatgccctggtcttcgtcctcttctgt
gatgaagtgaggcagtggtacatgaacggagtgaattatttcaccgacctatggaacgtt
atggacacactgggacttttctacttcatagcgggtattgtattccggcttcactcttca
aataaaagctctttgtactccgggcgagtcattttctgtctggattacattatattcact
ctaaggctcatccacattttcaccgtgagcaggaacctgggacccaagattataatgctg
cagcggatgctcatcgacgttttcttcttcttgtttctctttgctgtgtggatggtggcc
ttcggcgtagccagacaggggatccttaggcaaaatgaacagcgctggaggtggatcttc
cgctctgtcatctatgagccctacctggccatgtttggccaggtgcccagtgatgtggac
agtaccacatatgacttctcccactgcaccttctcgggaaatgagtccaagccactgtgc
gtggagctagatgaatacaatctgccccgcttccctgagtggatcaccatcccactagtg
tgcatctacatgctctccaccaacatccttctggtcaatctcctggtcgccatgtttggc
tacacggtgggcattgtgcaggagaacaacgatcaggtctggaagttccagcggtacttc
ctggtgcaggagtactgcaaccgcctcaacatccccttccccttcgtcgtcttcgcttac
ttctacatggtggtcaagaagtgtttcaaatgctgctgtaaagagaagaacacggagtct
tctgcctgctgtttcagaaatgaggacaacgagactttggcgtgggagggcgtcatgaag
gagaattaccttgtcaagatcaacacgaaggccaacgacaacgcagaggagatgaggcat
cggttcagacaactggacacaaagcttaatgatctcaaaggtcttctgaaagagattgct
aataaaatcaaataa

DBGET integrated database retrieval system