KEGG   Rattus norvegicus (rat): 171385
Entry
171385            CDS       T01003                                 

Gene name
Acmsd
Definition
(RefSeq) aminocarboxymuconate semialdehyde decarboxylase
  KO
K03392  aminocarboxymuconate-semialdehyde decarboxylase [EC:4.1.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
Module
rno_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    171385 (Acmsd)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.45  aminocarboxymuconate-semialdehyde decarboxylase
     171385 (Acmsd)
SSDB
Motif
Pfam: Amidohydro_2
Other DBs
NCBI-GeneID: 171385
NCBI-ProteinID: NP_599199
RGD: 620868
UniProt: Q8R5M5
Position
13q13
AA seq 336 aa
MKIDIHTHILPKEWPDLEKRFGYGGWVQLQQQGKGEAKMMKDGKVFRVIQQNCWDPEVRI
REMNQKGVTVQALSTVPVMFSYWAKPKDTLELCQFLNNDLAATVARYPRRFVGLGTLPMQ
APGLAVEEMERCVKELGFPGIQIGSHINMWDLNDPELFPIYTAAERLNCSLFVHPWDMQM
DGRMAKYWLPWLVGMPSETTTAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTIGRIAHGF
NMRPDLCARDNSSDPRKYLGSFYTDSLVHDPLSLKLLTDVIGKDRVILGTDYPFPLGEQE
PGKLIESMADFDEETKDKLTAGNALTFLGLERKLFE
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaattgacatccacactcacattctaccaaaggaatggcctgatctagaaaagagg
tttggctatggaggctgggtgcagctccaacagcaaggcaagggagaagcaaagatgatg
aaagacgggaaggtcttcagagtgatccaacagaactgctgggacccagaagtccgcatc
agagaaatgaaccagaaaggagtgacagtgcaagctctttccacagttcccgtcatgttt
agttactgggccaaacctaaggacactttggaactgtgccagtttttaaacaatgacctc
gctgccacggtggccagataccctcgaaggtttgtgggtttggggacattgcctatgcaa
gccccggggctggctgtcgaggagatggagcgttgtgtaaaggagctaggatttccagga
atccagattggatcccacatcaacatgtgggacctgaatgacccggaactcttccccatc
tacacggcggctgagaggctgaattgttctctgttcgtgcatccctgggatatgcagatg
gatggacggatggccaaatactggctgccttggctcgtaggaatgccatcggagaccacc
acggccatttgctccatgatcatgggtggggtgttcgagaagtttcccaaactcaaagtg
tgttttgcacatggaggtggtgctttccccttcaccataggaagaattgctcatggattt
aacatgcgcccagatctctgtgcccgggacaattcatctgaccccagaaaataccttggc
tccttctacacggactccctggttcatgatcctctgtctctcaagctattgacagatgtt
atagggaaggatagagttattctgggaactgattacccctttccactaggtgagcaggag
cctgggaagttgatagagtctatggcagactttgatgaagaaacaaaggataaacttaca
gctggcaatgccttgacttttttgggtcttgagagaaaactatttgaatga

DBGET integrated database retrieval system