KEGG   Rattus norvegicus (rat): 171398Help
Entry
171398            CDS       T01003                                 

Gene name
Ust5r
Definition
(RefSeq) integral membrane transport protein UST5r
  KO
K08206  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 9/10/19/24/25
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171398 (Ust5r)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   171398 (Ust5r)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    171398 (Ust5r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF5353
Motif
Other DBs
NCBI-GeneID: 171398
NCBI-ProteinID: NP_599207
RGD: 620985
Ensembl: ENSRNOG00000061890
UniProt: Q8VDA8
Position
1q43
AA seq 552 aa AA seqDB search
MAFQELLNQVGSLGRFQILQMAFVFLINVSVVPHSTIENFTAAIPSHRCWVPILDNVTVS
DNHSRILNQDKLLKISIPLDSHLRLDKCRRFAQPQWHLLDLNDTFSSVTEADTEPCVDGW
VYDRSNFHSTTVTEWDLVCESQVLNSVTKFSFMIGAFIGGNVNGPLSDRFGRKFVLKCAL
LQMAITETCVGFASNFFIYCSLRFLAGMTFEPILVNSNLLMFEWTSHKFLAMMSVMAPCA
GSFGSMILAGLAFQFQNWHHLQLAMSVPIFFFLILTRWLSESARWLIVTNKPQKGLKELR
KVAHMNGMKNSGDNLTMEVVRTSMKRELEAAKARPSPRDLFHTPILRKRICAMSFMRILF
MLSIFGMSLHLQHLSSNIMLLQFVVSASSLLFSVIGPYVFNRMGRRITQMVVMTLRGICI
LTAVFVPQEMQILRITVVTLAGAFSALSFGVNRLHTNELLPTTLRATAIGVIGMFGNSGF
FLAPLFMILASYSPNLPWIFYGGFSILNGFTVFLLPETKNQPLPDCIHDIGNDWEESRQE
MKEDPTIKVTRF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcaggaactcctgaatcaagtaggaagcctagggcgattccagatccttcag
atggcttttgtttttttaatcaatgttagtgtggtacctcatagtacaattgagaacttt
actgcagccattcccagtcatcgctgctgggtcccgatcctcgacaatgtcactgtctct
gataatcacagcagaatcctgaaccaagataaactcctgaagatctccatccccttggac
tcccacttgagactagataagtgtcgtcgttttgcccaaccacagtggcatcttctcgat
ttgaatgatactttctccagtgtcacagaagcagacactgagccctgtgtggatggctgg
gtatatgacaggagtaactttcattctaccactgtgactgagtgggacctggtgtgtgaa
tctcaggtactgaattctgtcactaaattttcatttatgattggtgcatttataggaggt
aatgtaaatggacctctatcagacaggtttgggaggaagttcgttttaaaatgtgcttta
ttacaaatggccatcactgaaacctgtgtaggttttgcttccaacttcttcatttattgc
tcattaagattcctggcaggaatgacttttgaacccattctagtaaatagtaacttgctc
atgtttgaatggacaagccataaattcctagccatgatgtcagtgatggcaccttgtgct
ggtagctttggaagcatgatattggcaggcctggcttttcaatttcaaaactggcaccac
ctccagctggcaatgtctgtaccaattttcttcttccttatactcacaaggtggctgtca
gagtcagctcggtggctcattgtgaccaacaaaccccagaagggcttaaaggaacttaga
aaagttgcacacatgaatggaatgaagaattctggagacaacctaaccatggaggttgta
agaacaagtatgaagagggaacttgaggcagcgaaggcgagaccttctccaagagacttg
ttccacacacccatcctacgtaagcggatatgtgccatgtcctttatgagaattttattt
atgctatcaatttttggcatgtcacttcacctccaacacctgagttctaatattatgttg
ttgcagtttgttgttagtgcatcatccttactattcagtgttattggaccttatgtattt
aatcggatgggccgtagaataacccaaatggttgtcatgaccctgaggggaatctgtatt
ctgactgctgtatttgtacctcaagaaatgcagatcctgcgtattactgtggttacattg
gcaggagcattttctgctctaagttttggtgttaatcgtctacatacaaatgaactactt
cccaccacgttaagggcaacagctataggagtcattggaatgtttggtaatagtggattt
ttcctggcacccctgtttatgatactagcgtcatattctcccaacttgccctggatcttc
tatggtggattctccatcctcaatgggtttactgtgtttctccttcctgaaaccaagaat
cagcctctgcctgattgcatccatgatataggaaatgattgggaagaatcaagacaagaa
atgaaggaggatcccaccattaaagtcacacggttttaa

DBGET integrated database retrieval system