KEGG   Rattus norvegicus (rat): 171400Help
Entry
171400            CDS       T01003                                 

Gene name
Elovl5, rELO1
Definition
(RefSeq) ELOVL fatty acid elongase 5
  KO
K10244  elongation of very long chain fatty acids protein 5 [EC:2.3.1.199]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno01040  Biosynthesis of unsaturated fatty acids
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
Module
rno_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    171400 (Elovl5)
   01040 Biosynthesis of unsaturated fatty acids
    171400 (Elovl5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    171400 (Elovl5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     171400 (Elovl5)
Lipid biosynthesis proteins [BR:rno01004]
 Elongase
  PUFA
   171400 (Elovl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 171400
NCBI-ProteinID: NP_599209
RGD: 620583
Ensembl: ENSRNOG00000006331
UniProt: Q920L7
Position
8q31
AA seq 299 aa AA seqDB search
MEHFDASLSTYFRALLGPRDTRVKGWFLLDNYIPTFVCSAIYLLIVWLGPKYMKNRQPFS
CRGILVVYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKVIRVLWWYYFSK
LIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM
YSYYGLSSVPSMRPYLWWKKYITQGQLVQFVLTIIQTSCGVIWPCSFPLGWLYFQIGYMI
SLIALFTNFYIQTYNKKGASRRKEHLKGHQNGSMTAVNGHTNNFASLENSVTSRKQRKD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaacatttcgatgcgtcactcagtacctatttcagggcattactgggcccccgagac
acacgagtcaaaggatggtttcttctggacaattacatccctacgtttgtctgctctgcc
atttatttactcatcgtgtggctgggaccaaaatacatgaaaaacaggcagccgttctct
tgccgaggcatcctggtggtgtataatcttgggctcaccctgctgtctctctacatgttc
tatgagttggtgacaggtgtgtgggaaggcaaatacaacttcttctgtcagggaacacgc
agcgcaggagaatcagatatgaaggttattcgtgtcctctggtggtactacttttccaaa
ctcatagaattcatggacacctttttcttcattcttcgtaagaacaaccaccagatcaca
gtcctgcacgtctaccaccatgccactatgctcaacatctggtggtttgtcatgaactgg
gttccctgcggccattcgtacttcggtgcgacgctcaacagcttcatccacgtcctcatg
tactcgtactatggcctgtcctctgtcccttccatgcgtccctacctctggtggaaaaag
tacatcactcaggggcagctggtccagtttgtgctgacaatcatccagaccagctgcggg
gtcatctggccgtgctccttccctctcgggtggctgtacttccagatcggatacatgatt
tccctgattgctctcttcacaaacttctacattcagacttacaacaagaaaggggcctct
cggaggaaagagcacctgaagggccaccagaacgggtctatgactgccgtcaatggacac
accaacaactttgcttccctggagaacagtgtgacgtcaaggaagcagcggaaggattga

DBGET integrated database retrieval system