KEGG   Rattus norvegicus (rat): 171433
Entry
171433            CDS       T01003                                 

Gene name
Micu2, Efha1, RGD1309934, Smhs2
Definition
(RefSeq) mitochondrial calcium uptake 2
  KO
K22828  calcium uptake protein 2, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    171433 (Micu2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    171433 (Micu2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 23S_rRNA_IVP
Other DBs
NCBI-GeneID: 171433
NCBI-ProteinID: NP_599223
RGD: 619739
Ensembl: ENSRNOG00000011168
UniProt: Q99P63 F1LMJ8
Position
15p12
AA seq 431 aa
MAAAAGRSARLAAWGERLRRGLAAGGRAVPSRGPLAAAVAGVALAGAGAAWHHGRVKAAA
RESTLTGLVQKNDLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFERMDRKTL
VKKLAKKDIEDVLSGIQTARCGSTFFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKM
LDADGNEMIERKEFVKLQKIISKQDGFKTVKTNEIEYQEPTVNEPGLNTTLQVRFFGKRG
EKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKEDFAEWLLFFTNSENKDIYWKNV
REKLSVGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELS
NNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGLWVSQQQSVQEYWKCVKKESIKGVK
EAWKQAGKGPF
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcggcggctgcgggaagaagcgctcggctggcggcctggggcgaaaggctgcggcgc
gggcttgcggcgggcggacgagctgtgccgagtcgcggccctctggcagcggctgtggcc
ggcgtggccctggcaggcgcaggagcagcatggcatcacggacgcgtgaaagcagccgcg
cgcgagagcacccttacggggttggtgcagaaaaatgacttgggaccaatagagaaactt
tctctccgcaaacagcggttcatgcagttttcctcactggagcatgacggagagtattac
atgacgccccgagacttcctcttctcagtgatgtttgagcgaatggatcgtaaaacacta
gtcaagaagctggcaaaaaaggatatcgaggatgtactgtcaggaatccaaacagcacgt
tgtggatcaacgttttttagagacctaggcgataaaggggtaatttcatatactgagtat
cttttcttgcttacgatcctcacaaagcctcactctgggttccatgttgcttttaaaatg
ctggatgcagatggtaatgagatgattgagagaaaggagtttgttaagctgcagaagatc
ataagtaagcaagatggcttcaagacagtgaagactaatgagatagaataccaggaacca
acagtgaacgagcctggccttaacacaacccttcaagtgcgtttctttgggaaaagagga
gaaaaaaagcttcattataaagaatttcgaagatttatggaaaatttacaaacagaagtt
caagaaatggaattccttcagttttctaaaggtttgaatttcatgagaaaagaagacttt
gcagagtggctacttttcttcactaactctgaaaataaagacatttactggaaaaatgtg
agagaaaagttgtcagtaggagagagcattagtttggatgagttcaagtccttctgccat
tttacaacacatttggaagacttcgctatcgccatgcagatgttcagtttagctcatcgc
cctgtgaggctggcggagttcaagagagctgtgaaagtggcgactggacaagagctttcc
aacaatcttctggacactgtcttcaagatctttgacctggacggggacgaatgcctcagc
cacggggagtttcttggagtactgaaaaacaggatgcatcgaggtttatgggtgtcgcag
cagcagagtgtgcaagaatactggaagtgcgtgaagaaggaaagcattaagggagtgaag
gaggcctggaaacaggccgggaagggccctttctga

DBGET integrated database retrieval system