KEGG   Rattus norvegicus (rat): 171442Help
Entry
171442            CDS       T01003                                 

Gene name
Svop
Definition
(RefSeq) SV2 related protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 171442
NCBI-ProteinID: NP_599231
RGD: 620277
Ensembl: ENSRNOG00000000693
UniProt: Q9Z2I7
Position
12q16
AA seq 548 aa AA seqDB search
MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEF
ANPTDDTFMVEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSW
QVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVFWTLYYGILSAFAPVYSWILVLR
GLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWL
LLLSAAPLLVFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIILKQE
DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAK
CSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFVIFSLCSLLLFIC
IGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQ
VMLESSVYLTLAVYSGCCLLAALASCFLPIETKGRALQESSHREWGQEMVGRGTNSTGVP
RSNSGSQE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacctgttccagctcaggcagttgccggtggtgaaattccgccgcacagga
gagagcgcacggtcagaggacgacgcggcttccggggaacatgatgttcagattgagggg
gtccgagtgggcctagaagctgtcgagctggatgatggagcagctgtccccaaggagttt
gccaatcccactgatgacactttcatggtcgaagatgcggtggaagccattgggttcgga
agattccagtggaagctctctgttctcaccggcttggcttggatggcggacgccatggag
atgatgattctgagcatcctggcgcctcagctgcactgtgagtggcgactccccagctgg
caggtggcgctgctgacttcggtggtcttcattggtatgatgtccagttctacgctctgg
ggaaacatctcggatcagtatggcaggaaaacagggctgaagatcagtgtgttctggacc
ctgtactacggcatcctcagcgctttcgcgccagtgtatagctggatcctggtgctccga
ggcctcgtgggctttgggattggaggggtgcctcagtcggtgaccctgtacgccgagttc
ctccccatgaaggccagagccaagtgcattttgctgattgaggttttctgggccatcggg
accgtgttcgaggtgcttctggctgtgtttgtgatgcccagcctgggctggcgctggctg
ctgctgctgtcggccgctccactacttgtctttgctgttctgtgtttctggctgccagag
agtgctaggtacgatgtgctgtctgggaaccaggaaaaggcgattgctacattaaagcgg
atcgcaacagaaaatggagcccccatgcctctggggaagctcatcatcttgaaacaggaa
gaccgaggcaaaatgagggaccttttcacaccccactttcgttggacaactctgctgctg
tggtttatatggttctccaatgccttctcttattacggcttggttctgctcaccacagaa
ctcttccaggccggagatgtttgcagcatctccagccggaagaaggcggtggaagccaaa
tgcagcctggcttgtgagtacctcagcaaagaggattacatggacctgctgtggaccacc
ctgtctgagttcccaggtgtccttgtgactctgtgggtcatcgaccgcctgggccgcaag
aagaccatggctctgtgtttcgtcatcttttccctctgcagcctcctgctgttcatctgc
attggaagaaatgtgctaaccctcttactgttcattgcaagagcgtttatttctggaggc
ttccaagcagcctacgtttacacgcctgaggtgtatccaacggcgacgagggcgctgggc
ctgggcacctgcagcggcatggcgagagtgggcgcgctcatcactccattcatagctcag
gtgatgctggaatcttccgtgtacctgaccctggccgtctacagtggctgctgcctcctt
gctgccttggcctcctgctttctgcccatcgagaccaaaggccgagcactgcaggagtcc
agccaccgggagtggggccaggagatggttggccgagggacaaacagcacaggcgtcccc
aggtcgaactctggctctcaggagtag

DBGET integrated database retrieval system