KEGG   Rattus norvegicus (rat): 171444Help
Entry
171444            CDS       T01003                                 

Gene name
Pacs1, Pacs-1
Definition
(RefSeq) phosphofurin acidic cluster sorting protein 1
  KO
K23290  phosphofurin acidic cluster sorting protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171444 (Pacs1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   Others
    171444 (Pacs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pacs-1
Motif
Other DBs
NCBI-GeneID: 171444
NCBI-ProteinID: NP_599233
RGD: 620579
Ensembl: ENSRNOG00000020350
UniProt: O88588
Position
1q43
AA seq 961 aa AA seqDB search
MAERGGAGGGPGGAGGGSSQRGSGVAQSPQQQPPQQPSQPQQPTPPKLAQATSSSSSTSA
AAASSSSSSTSTSMAVAVASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRLFS
LTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIILPASGLVETELQLTFSLQYPHF
LKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKDVS
VPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQDLF
YEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGFGLEHVSREQIREV
EEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLKPFFEGMSQSSSQTEIGSLNSKG
SLGKDTTSPMELAALEKVKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTP
MKSSKADLQGSASPSKVEGTHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQ
IPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAV
LSALLTRIQRYCNCNSSMPRPVKVAAVGSQSYLSSILRFFVKSLASKTPDWLGHMRFLIV
PLGSHPVAKYLGSVDSRYSSTFLDSAWRDLFSRSEPPVSEPLDVVGRVMQYVNGATTTHQ
LPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPSTSP
PSSSGLSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRD
ASSKNTLKSVFRSVQVSRLPHAGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEVDS
KSQVIEGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKP
T
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgtggaggggcgggcggtggtcccggaggcgccgggggcggcagcagtcag
cggggctctggggttgcccagtccccgcagcagcagccgccgcagcagccatctcagccg
caacagccaacgccccccaaactggcccaggccacctcgtcctcctcgtccacctcggct
gcggccgcctcctcctcgtcctcctccacctccacctccatggccgtcgcggtggcctcg
ggctctgcgcctcccggcggtccgggaccaggccgcacccccgccccagtgcagatgaat
ttgtatgctacctgggaggtggaccggagctcatccagctgcgtgcccagactcttcagt
ttgactctgaagaaacttgttatgcttaaagaaatggacaaagatcttaactcagtagtc
attgctgtgaagctgcagggttcaaaaaggattcttcgctctaatgagatcatccttcca
gccagtggcctggtggaaacagagctccagttaaccttctccctccagtaccctcatttc
cttaagcgagatgccaacaaactgcagattatgttgcaaaggaggaagcggtacaagaac
cggactatcttgggctataaaaccttggctgtgggactcatcaacatggcagaggtgatg
caacaccctaacgagggtgctttagtacttggcctgcatagcaacgtaaaggatgtctct
gtgcctgtggcagaaataaaaatctactctttatccagccagcccattgaccatgaagga
atcaagtctaagctgtctgatcgctccccagatattgacaactactctgaagaagaggag
gaaagcttctcctcagagcaggaaggcagtgatgacccattacatggacaggacctattc
tatgaagatgaagatcttcggaaagtaaagaagactcgaaggaaactgacctcaacctca
gccatcactaggcaaccgaacatcaaacagaagtttgtggccctcctgaaacgattcaaa
gtttctgatgaggtgggctttgggctagaacatgtgtcaagggagcagattcgggaagtg
gaagaggacctggatgaactatacgacagtctagaaatgtacaaccccagcgacagtggc
cctgagatggaagaaacagaaagcatcctcagcaccccaaagcccaagctcaagcccttc
tttgaggggatgtctcagtccagctcacagacggagatcggcagtctcaacagcaagggc
agccttggaaaagacaccaccagccctatggaattggcagctttagaaaaagttaagtct
acttggattaaaaaccaagatgacagcttgactgaaacagacactttagaaatcactgac
caggacatgtttggagatgcgagcacaagtctggttgtaccagaaaaagtcaaaactcct
atgaagtccagcaaagctgatctgcagggctccgcctcgccgagcaaggtggaagggaca
cacacacctcgccaaaagaggagcactcccctgaaggagcggcagctctccaagcccctg
agtgagaggaccaacagctctgacagtgagcgctctcctgacctagggcacagcacacag
attccacgaaaggtggtatacgatcaactgaatcagatcctggtttccgatgcagcgctc
cctgagaatgtcatcctggtgaacaccacggactggcagggccagtatgtggccgaattg
cttcaagaccagaggaagcctgttgtgtgtacctgctcaacagtggaggtccaggccgtg
ttgtctgccctgctcactaggattcagcgctactgcaactgcaactcatctatgccgagg
ccagtcaaggtggcagctgtgggcagccagagttacctgagctccatccttcggtttttt
gtcaagtcccttgccagcaagaccccggactggctgggccacatgcgcttcctcatcgtt
cccctaggttctcatccagtggccaaatacttgggctcagtagatagtagatatagcagc
acctttcttgattctgcttggagagacctgttcagtcgctcagagcctccagtgtcagag
ccactggatgtggtgggtcgtgtgatgcagtatgtcaatggagctaccacaacgcaccag
ctgcctgtggctgaagccatgttgacctgcaggcataagttccctgatgaagactcctac
cagaagtttatccccttcattggtgttgtgaaagtgggccttgttgaagactcgccctcc
actgcaggtgatggggacgattcacctgtggtcagccttactgtgccctccacatcacca
ccctcaagctcgggcctgagccgagatgccacagctacccctccctcatccccatccatg
agcagtgccctcgccatcgtggggagcccaaatagcccttatggggatgtgattggcctc
caggtggattactggctgggccaccctggggagcgaaggagagaaggtgataagagggac
gccagttcaaagaataccctcaagagtgtcttccgctcagtgcaggtttctcgcctgccc
catgcaggggaagcccagctttctggcaccatggcaatgactgtggtcaccaaagagaag
aacaagaaagtgcccactatcttcctgagcaagaagccccgggaaaaggaggtggattct
aagagccaagtcatcgagggcatcagccgcctcatctgttctgcaaagcagcagcaaacc
atgctgagagtgtccattgatggagttgaatggagtgacatcaagttcttccagctggca
gctcagtggcccactcatgtcaagcacttcccagtgggactcttcagtggcagcaaaccc
acctga

DBGET integrated database retrieval system