KEGG   Rattus norvegicus (rat): 171503Help
Entry
171503            CDS       T01003                                 

Gene name
Camk1, Camki, Gaip
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno05214  Glioma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    171503 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    171503 (Camk1)
   04925 Aldosterone synthesis and secretion
    171503 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    171503 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171503 (Camk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     171503 (Camk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   171503 (Camk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase
Motif
Other DBs
NCBI-GeneID: 171503
NCBI-ProteinID: NP_604463
RGD: 629473
Ensembl: ENSRNOG00000021781
UniProt: Q63450
Structure
PDB: 

Position
4q42
AA seq 374 aa AA seqDB search
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPTAGGPAAGCCCRDCCVEPGS
ELPPAPPPSSRAMD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggcagtggaaggccccaggtggaagcaggcagaagacattagggatatttat
gacttcagggatgttctgggcacgggtgccttctcagaagtgatcctggcagaggacaag
aggactcagaaactggtggccatcaaatgcattgccaagaaggccctggagggcaaagaa
ggcagcatggagaatgagatcgccgtcttacacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggccacctctacctcatcatgcagctggtttcaggt
ggagagctgtttgaccgaattgtggagaaaggattctacacagaacgggatgccagccgc
ctcatcttccaggtgctggatgctgtcaagtacctgcacgacctgggcattgtgcaccgg
gatctcaagccagagaacctgctatactacagtctggatgaagactccaaaatcatgatc
tctgactttggcctctccaagatggaggacccaggcagtgtgctctccacagcctgtggg
actccaggatatgtggcccctgaggtcctggcccagaagccctacagcaaggccgtggac
tgctggtccataggagtcattgcctatatactgctctgtggctacccgccgttctatgat
gaaaatgatgccaaactttttgaacagattttgaaggctgagtatgagtttgactctcct
tattgggacgacatctctgactctgccaaagatttcatacgtcatttgatggagaaagac
ccagagaagaggttcacctgtgagcaggccttgcagcacccctggattgcaggagacaca
gctctggataagaatatccaccagtcagtgagtgagcagatcaagaagaactttgccaag
agcaagtggaagcaagctttcaatgctaccgctgtggttcggcacatgaggaagctgcag
ctgggcaccagccaggagggacagggacagacagctagccacggagagctgctgacaccc
acagctggggggccagcagctggctgctgctgtcgagactgctgtgtggagccaggctca
gaactgccccctgcaccacccccaagctctagggccatggactga

DBGET integrated database retrieval system