KEGG   Rattus norvegicus (rat): 171516Help
Entry
171516            CDS       T01003                                 

Gene name
Akr1c3, Akr1c18
Definition
(RefSeq) aldo-keto reductase family 1, member C3
  KO
K05295  20alpha-hydroxysteroid dehydrogenase [EC:1.1.1.149]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    171516 (Akr1c3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.149  20alpha-hydroxysteroid dehydrogenase
     171516 (Akr1c3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 171516
NCBI-ProteinID: NP_612519
RGD: 708428
Ensembl: ENSRNOG00000017531
UniProt: P51652
Position
17q12.2
AA seq 323 aa AA seqDB search
MNSKIQKMELNDGHSIPVLGFGTYATEENLRKKSMESTKIAIDVGFRHIDCSHLYQNEEE
IGQAIVSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPV
SLKPGDELLPQDEHGNLILDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKP
GLKHRPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPI
LCTMAKKYKRTPALIALRYQLERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNLD
RNLRYFPANMFKAHPNFPFSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaaattcagaagatggagttaaacgatggtcactccatccctgtactgggc
tttggcacctatgcaaccgaagagaatctcagaaaaaagtctatggagtccacgaaaata
gctatagatgttgggttccgccatattgattgttctcacttgtaccagaatgaagaagag
ataggtcaggccattgtaagcaagattgaagatggcactgtgaaaagggaagatatattc
tatacttcaaagctttggtcaacttcccatcgtccagagttggtcagacccagcttggaa
aattcactgaggaaacttaatttggactatgtagacctctatctcattcatttcccggta
tctctgaagccaggggatgagcttttacctcaagatgagcatggaaacttaatacttgac
acagtggatctctgcgacacctgggaggccatggagaagtgtaaggatgcaggattggcc
aagtccatcggggtgtccaactttaaccgcaggcagctggagaagatcctgaataagccg
gggctcaagcacaggcctgtgtgcaaccaggtagaatgccatctttatctcaaccagagc
aagctgctcgcttactgcaagatgaatgacatcgttctggttgcctatggtgccctggga
actcagagatacaaatactgtattaatgaagataccccagttctcttggatgatcccatt
ctttgtaccatggcaaagaagtacaagcggactccagccctgattgcccttcgctaccag
ctggagcgtgggattgtgaccctagtcaagagtttcaatgaggagagaatcagagagaac
ctgcaggtctttgatttccagttggcttcagatgacatggaaattttagataacctggac
agaaatcttcggtactttcctgctaatatgtttaaggctcaccctaactttccattctct
gatgaatactaa

DBGET integrated database retrieval system