KEGG   Rattus norvegicus (rat): 171517
Entry
171517            CDS       T01003                                 

Gene name
Gpc2
Definition
(RefSeq) glypican-2 precursor
  KO
K08108  glypican 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    171517 (Gpc2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    171517 (Gpc2)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   171517 (Gpc2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  171517 (Gpc2)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 171517
NCBI-ProteinID: NP_612520
RGD: 621363
Ensembl: ENSRNOG00000001367
UniProt: P51653
Position
12
AA seq 579 aa
MSAVRPLLLLLLPLCPGPGPGHGSEAKVVRSCAETRQVLGARGYSLNLIPPSLISGEHLQ
ICPQEYTCCSSETEQKLIRDAEVTFRGLVEDSGSFLIHTLAARHRKFNEFFREMLSISQH
SLAQLFSHSYGRLYSQHAVIFNSLFSGLRDYYEKSGEGLDDTLADFWAQLLERAFPLLHP
QYSFPPDFLLCLTRLTSTADGSLQPFGDSPRRLRLQITRALVAARALVQGLETGRNVVSE
ALKVPMLEGCRQALMRLIGCPLCRGVPSLMPCRGFCLNVAHGCLSSRGLEPEWGGYLDGL
LLLAEKLQGPFSFELAAESIGVKISEGLMHLQENSVKVSAKVFQECGTPHPVQSRNRRAP
APREETSRSWRSSAEEERPTTAAGTNLHRLVWELRERLSRVRGFWAGLPVTVCGDSRMAA
DLSQEAAPCWTGVGRGRYMSPVVVGSLNEQLHNPELDTSSPDVPTRRRRLHLRAATARMK
AAALGQDLDMHDADEDASGSGGGQQYADDWKAGAAPVVPPARPPRPPRPPRRDGLGVRGG
SGSARYNQGRSRNLGSSVGLHAPRVFILLPSALTLLGLR
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtccgcggtgcgacctctcctgcttttgctgctccctctgtgtcccggtccaggaccg
ggacatgggagtgaagcaaaggtcgtccggagttgtgcagagactcggcaggtgctgggg
gcccggggatatagcttaaaccttatccctccctccctcatctcaggtgagcaccttcag
atctgtcctcaggagtacacctgctgttccagtgagacagagcagaagttgatccgggat
gctgaggtcaccttccgtggcttggtggaagacagtggctccttcctgattcacacgctg
gctgcccgccacagaaagtttaacgagttttttcgggagatgctgtctatatcccagcat
tctttggcccagctcttctcgcattcctatggtcgcctgtattcccagcatgccgtcatc
ttcaatagcctgttctccggcctgcgggactactatgagaagtctggcgaggggttagat
gacaccttggcagacttctgggcccagctcctggagagagccttccctttgctgcaccca
caatacagtttccctcctgatttcctgctctgccttactcggctcacttcaactgctgat
ggctctctgcagcccttcggggactcaccccgccgcctccgcctacagataacccgggca
ctggtggcagcccgggccttggtccagggtctggagaccggaagaaatgtggtcagcgaa
gcacttaaggtacccatgttggaaggctgcagacaggccctcatgcgtctgatcggctgc
ccactttgtcggggagtaccctcgcttatgccctgccggggcttctgcctcaatgtggcc
cacggctgtctcagcagcaggggattggagcctgaatggggcggatatctggatggtctc
ctgctgctggctgagaaactccagggacccttttccttcgagctggctgctgagtccata
ggggtgaagatctcagaaggtttgatgcacttgcaggaaaacagtgtaaaggtgtcagcc
aaggtgtttcaggaatgtgggacgcctcacccggtgcaatcccgtaaccggcgagcacca
gcaccccgggaagagactagccggtcttggaggtcgtcagctgaggaagaacgccccaca
acagcggcaggcactaatctgcaccgtctggtttgggagctccgagagaggcttagccga
gtgcggggcttctgggctggacttcccgttacggtgtgtggggactcccgcatggcggca
gatctctcccaggaggcggcaccctgctggactggggttgggagaggccggtatatgtcg
cctgtggtcgtgggctccttgaacgagcagctccataacccggagttggatacttcgagt
cccgatgtcccgacacgtcggcggaggctccatctccgagcagctactgctcgaatgaag
gcggctgcgctgggccaggaccttgacatgcatgatgcggatgaagacgccagtggctcc
ggagggggacagcagtacgcagacgactggaaagctggggcagcgcctgtggttccccca
gccaggcctccaaggccacctcgtcctcctcgaagggatggtcttggagtgagaggagga
agtggcagtgccagatacaaccagggccgaagcaggaatctggggtcgtctgttggcctc
catgccccacgtgtcttcattctcctcccctcagccctgaccctgcttggacttcgataa

DBGET integrated database retrieval system