KEGG   Rattus norvegicus (rat): 171518
Entry
171518            CDS       T01003                                 

Gene name
Cyp2c22, Cyp2c70
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 22
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    171518 (Cyp2c22)
   00590 Arachidonic acid metabolism
    171518 (Cyp2c22)
   00591 Linoleic acid metabolism
    171518 (Cyp2c22)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    171518 (Cyp2c22)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    171518 (Cyp2c22)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    171518 (Cyp2c22)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    171518 (Cyp2c22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    171518 (Cyp2c22)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     171518 (Cyp2c22)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   171518 (Cyp2c22)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 171518
NCBI-ProteinID: NP_612521
RGD: 620368
Ensembl: ENSRNOG00000021924
UniProt: P19225
Position
1q54
AA seq 489 aa
MALFIFLGIWLSCLVFLFLWNQHHVRRKLPPGPTPLPIFGNILQVGVKNMSKSMCMLAKE
YGPVFTMYLGMKPTVVLYGYEVLKEALIDRGEEFSDKMHSSMLSKVSQGLGIVFSNGEIW
KQTRRFSLMVLRSMGMGKRTIENRIQEEVVYLLEALRKTNGSPCDPSFLLACVPCNLISS
VIFQHRFDYSDEKFQKFIENFHTKIEILASPWAQLCSAYPVLYYLPGIHNKFLKDVTEQK
KFILMEINRHRASLNLSNPQDFIDYFLIKMEKEKHNEKSEFTMDNLIVTIGDLFGAGTET
TSSTIKYGLLLLLKYPEVTAKIQEEITRVIGRHRRPCMQDRNHMPYTDAVLHEIQRYIDF
VPIPLPRKTTQDVEFRGYHIPKGTSVMACLTSALHDDKEFPNPEKFDPGHFLDEKGNFKK
SDYFMAFSAGRRACIGEGLARMEMFLILTSILQHFILKPLVNPEDIDTTPVQPGLLSLPP
PFQLCFIPV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctctcttcatttttctggggatttggctttcttgtttggtttttctttttctatgg
aatcagcaccatgtcagaaggaagctcccacctggtcccactcctctaccaatttttggc
aatattttgcaagtgggtgttaaaaatatgagcaaatctatgtgcatgctagcaaaagag
tacgggcctgtgttcaccatgtatctgggcatgaagcccactgtggtgctgtatggatat
gaagtattgaaagaagctctgattgaccggggagaagagttttctgataaaatgcattcg
tcaatgctcagtaaagtcagccaagggttaggcattgtcttcagcaatggagaaatatgg
aaacaaacacggcgtttctccctcatggtcttaaggtctatggggatgggaaagagaact
attgaaaaccgaattcaggaggaagttgtttatctgctggaagcactgagaaaaaccaat
gggtccccgtgtgaccccagcttccttctggcctgtgttccctgcaatctgatctccagt
gtcattttccagcaccgttttgactacagtgatgagaaattccaaaaattcatagagaat
ttccatacaaaaattgaaattttagcatctccttgggcccagttgtgcagtgcctatcct
gttctatactatctcccgggaatccataacaaattcttaaaagatgtgactgaacagaaa
aagttcatcttgatggaaataaacaggcatcgagcatctctgaacctcagtaaccctcag
gactttattgactatttcctgattaaaatggaaaaggaaaaacacaatgaaaagtctgaa
tttaccatggacaacctgatagtcaccataggtgatctttttggagcaggaacagagaca
acgagttccaccataaaatatgggcttttgctcttgctgaagtacccagaggtcacagct
aaaattcaggaagaaattactcgcgtgattggtagacaccggagaccctgcatgcaggac
aggaaccacatgccctatacggatgctgtgctgcatgagatccagagatacattgatttt
gttcccattcccttgcctcgtaagacaacgcaggatgtggagttcagaggataccacatt
cccaagggcacaagcgtaatggcatgtctgacttctgccctgcacgatgacaaagaattt
cccaacccagagaagttcgaccctggccactttctcgatgagaaaggcaacttcaagaag
agtgactacttcatggctttctcagcaggaagaagagcctgtattggagaaggtttagcc
cgcatggagatgttcttaatcctgaccagcattttacagcattttattttaaaacctctt
gtcaatccagaggacatcgacacaaccccagttcaacctggtttattgtctctgccccca
ccctttcagctctgtttcattccagtctga

DBGET integrated database retrieval system