KEGG   Rattus norvegicus (rat): 171521Help
Entry
171521            CDS       T01003                                 

Gene name
Cyp2c13, Cyp2c38
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 13
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    171521 (Cyp2c13)
   00590 Arachidonic acid metabolism
    171521 (Cyp2c13)
   00591 Linoleic acid metabolism
    171521 (Cyp2c13)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    171521 (Cyp2c13)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    171521 (Cyp2c13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    171521 (Cyp2c13)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    171521 (Cyp2c13)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     171521 (Cyp2c13)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   171521 (Cyp2c13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 171521
NCBI-ProteinID: NP_612523
RGD: 620363
Ensembl: ENSRNOG00000049464
Vega: OTTRNOG00000002298
UniProt: P20814 Q5I0P5
Position
1q53
AA seq 490 aa AA seqDB search
MDPVVVLLLSLFFLLFLSLWRLSSGRGKLPPGPTPLPIIGNFFQVDMKDIRQSLTNFSKT
YGPVYTLYVGSQPTVVLHGYEALKEALVDHGEEFSGRGRLPICEKVAKGQGIAFSHGNVW
KATRHFTVKTLRNLGMGKGTIEDKVQEEAKWLVKELKKTNGSPCDPQFIMGCAPGNVICC
IILQNRFDYEDKDFLNLIEKVNEAVKIISSPGIQVFNIFPILLDYCPGNHNIYLKNYTWV
KSYLLEKIKEHEESLDVSNPRDFIDYFLIERNQENANQWMNYTLEHLAIMVTDLFFAGIE
TVSSTMRFALLLLMKYPHVTAKVQEEIDHVIGRHRSPSMQDRSHMPYTNAMVHEVQRYID
IGPNGLLHDVTCDTKFRNYFIPKGTAVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFK
KSDYFIPFSAGKRMCLGESLARMELFLFLTTILQNFKLKSLVDPKDINTTPICSSLSSVP
PTFQMRFIPL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccagttgtggtcttgttgctcagtctgttctttctgcttttcctgtctctatgg
agactgagctctgggagagggaaactccctcctggcccaactcctctcccaattattgga
aatttctttcaggttgatatgaaggacattcggcaatccttaaccaatttttctaaaacc
tatggacctgtgtatactctgtatgttggctcacagcctactgtggtattgcatggctat
gaggcattgaaagaagctcttgttgatcatggggaagaattctctggaagaggaaggtta
ccaatttgtgaaaaggttgctaaaggacagggcattgcttttagccatggaaatgtatgg
aaagccacaaggcatttcacagtcaaaaccctgaggaatttgggcatgggaaaagggacc
attgaagacaaagtgcaagaggaagcaaagtggctagtgaaagaactgaagaaaaccaat
ggctcaccctgtgatccccaattcatcatgggatgtgctcctggcaatgtcatctgctgc
attatcttgcagaatcgttttgattatgaagataaggattttcttaacttgatagaaaaa
gtgaatgaggccgttaaaattataagctctcctgggattcaggttttcaatatatttcct
atacttcttgattattgtccgggaaatcataacatatatttaaaaaattatacatgggtt
aagagttaccttttggagaaaataaaagaacatgaagaatcgttggatgtttcaaatcct
cgggacttcattgattattttctaattgaaagaaatcaggaaaatgccaatcagtggatg
aactatacacttgaacacctggcaatcatggtgactgatttgttttttgctggaatagag
acagtaagctcaacaatgagatttgctctcctgctcttgatgaagtacccacacgtcaca
gctaaagtccaggaagagattgaccatgtgattgggagacaccgcagcccctctatgcag
gacaggagccacatgccctacacaaatgccatggtccacgaggttcagagatacattgac
attggtccaaatggtctgcttcatgatgtgacctgtgacactaaattcagaaactacttc
ataccgaagggaacagcagtactaacatcacttacatcagtgctgcatgacagcaaggag
tttcccaacccagagatgtttgacccaggtcactttctagatgagaatggaaactttaag
aaaagtgactacttcattcctttctcagcaggaaaacggatgtgtttgggagagagcctg
gcccgcatggagctgtttctattcctgacaaccattttacagaatttcaaactaaaatct
ctggttgacccaaaggacatcaatacaaccccaatatgttcttcactttcttcagttcct
cccactttccagatgcgcttcatccctctctaa

DBGET integrated database retrieval system