KEGG   Rattus norvegicus (rat): 171547Help
Entry
171547            CDS       T01003                                 

Gene name
Crispld2, Lcrisp2, Lgl1
Definition
(RefSeq) cysteine-rich secretory protein LCCL domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LCCL CAP Rxt3
Motif
Other DBs
NCBI-GeneID: 171547
NCBI-ProteinID: NP_612527
RGD: 620860
Ensembl: ENSRNOG00000016752
UniProt: G3V9T1
Position
19q12
AA seq 497 aa AA seqDB search
MSCLLNNMVPVGLALLVCGVQAFFLPNTMSLERLLSKYQHTEPHSRVRRAIPMSDRQEIL
MLHNKLRGQVYPPASNMEYMTWDEELERSAAAWAQRCLWEHGPASLLVSIGQNLAVHWGR
YRSPGFHVQSWYDEVKDYTYPYPHECNPWCPERCSGAMCTHYTQMVWATTNKIGCAVHTC
RSMSVWGDIWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCRNNLCYREEHY
HQKPEVDEMNEVESPPAPEETHVWVQPRVVKPSKTKKTPVVNFMTQVVHCDTKMKDSCKG
STCNRYQCPAGCLNNKAKVFGSLFYESSSSICRAAIHYGVIDDRGGLVDVTRNGMVPFFV
KSQKNGLESLSKYKPSSSFTVSKVKETAVDCHTTVAQLCPFEKPATHCPRVRCPSRCGEE
PSYWAPVYGTNIYADTSSICKAAVHAGVIVDEVGGYADVMPVDKKKSYVGSLRNGVQSES
PSTPQNGNAFRIFPVRQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtcttctgaacaatatggtcccggtggggctggctctgctggtctgcggagta
caggcctttttccttcccaacaccatgagcctggagaggctgctcagcaagtaccagcac
acagagccacactcacgcgtgcgcagggccatccccatgtcagaccgtcaggaaatcctc
atgctgcacaacaagctgcgaggtcaggtgtatccccctgcctccaacatggagtacatg
acctgggatgaggagctggagaggtcggcagccgcgtgggcacagaggtgcctgtgggag
catgggcccgccagccttctcgtgtccatcgggcagaacctggctgtgcactggggcagg
taccgctctcctgggttccacgtgcagtcgtggtatgacgaggtgaaggattacacctac
ccgtacccccacgagtgcaacccatggtgccccgagcgctgctcaggagccatgtgcacc
cactacacacagatggtttgggccaccaccaacaagattggctgtgctgtgcacacctgt
cggagcatgagcgtctggggagacatctgggagaacgccgtgtatctcgtctgcaattat
tctccaaagggaaactggattggtgaggctccctacaaacatggccgcccctgctctgag
tgtccgtccagctatggaggtggctgtcggaacaacctgtgttaccgagaagagcactac
catcagaaaccagaggtggatgagatgaacgaggtggaatcgccccctgctcccgaggaa
acccatgtctgggttcaacccagggtggtcaaaccctcaaagaccaagaagaccccagtc
gtcaacttcatgacccaagtggtccactgtgacacaaagatgaaggactcatgcaaggga
tccacatgtaacaggtaccagtgcccagcaggctgtctgaacaacaaggcgaaggtcttt
ggctctctgttttatgaaagttcttccagtatatgtcgagctgctatccactatggtgtc
atcgatgatcgaggtggcctggtggatgtcaccaggaatgggatggtacccttctttgtc
aaatctcagaaaaatggcttggagtccctgagtaaatacaagccgtctagctccttcact
gtgtccaaagtgaaagagacggctgtggactgccacaccacagttgcacagctatgcccc
ttcgagaagccagccacccactgcccgagagtccggtgtccttcacgatgtggagaggag
ccatcctattgggcccctgtgtatggaaccaacatctacgctgacacttccagcatctgt
aaggcggctgtgcatgcaggcgtcattgtcgacgaggttggtggctatgcagatgtgatg
cccgtggacaaaaagaagagctacgtgggctccctcaggaacggggttcagtcagagagc
ccgagcactcctcagaacggaaacgccttccggatcttccccgtcaggcagtga

DBGET integrated database retrieval system