KEGG   Rattus norvegicus (rat): 171548Help
Entry
171548            CDS       T01003                                 

Gene name
Dkk3, Reic, p29
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Dickkopf_N UPF0506 Conotoxin_I2 V-ATPase_G_2 Lipoprotein_2
Motif
Other DBs
NCBI-GeneID: 171548
NCBI-ProteinID: NP_612528
RGD: 621846
Ensembl: ENSRNOG00000016343
UniProt: B1H219
Position
1q33
AA seq 348 aa AA seqDB search
MQWLRDILLCMLLAAVVPTAPTPAPTATWTPAEPGPALNYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAARTSSEVTLSSLPANYHNETNTETRMENNTAHVHREVHKITN
NQSGQTVFSETVITSVEDGEGKKSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTR
DSECCGDQLCAWGHCTQKATKGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL
CHDPTSQMLDLITWELEPEGALDRCPCASGLLCQPHSHSLVYMCKPAFVGSHDHNEESQL
PREALDDYEDVGFIGEVRQELEDLERSLAQEMAFEEATPVDSLGGEKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggctccgggatattttgctgtgtatgctgctagcggcggtggtccccactgcc
cccactcctgccccgacggccacttggactccggcagagccgggcccggctcttaactac
cctcaggaggaagctacgctcaatgagatgttccgagaggtagaggagctgatggaagac
actcagcacaaactgcgcagcgcggtggaggagatggaggcggaagaagcggctgctaga
acgtcctctgaggtgaccctgtcaagtttacctgccaactaccacaacgagaccaacacg
gagaccaggatggaaaataacacagcccatgtgcaccgggaggttcacaagataaccaac
aaccagagtggacagacggtcttttctgagacagtcattacatctgtagaggatggagaa
ggcaagaagagccatgaatgtatcattgatgaggactgcggacccaccaggtactgccag
ttctccagcttcaagtatacctgccagccgtgccgggaccagcagatgctatgcacccga
gacagtgagtgctgtggagaccagctttgtgcctggggtcactgcacccaaaaggccacc
aaaggtagcaatgggaccatctgtgacaaccagagggattgccagcctggcctgtgctgc
gccttccaaagaggcctgctgttccctgtgtgcacacccctgcccgtggagggggagctc
tgtcatgaccccaccagccagatgctggacctcatcacctgggaactggagcctgaaggc
gctttggaccgatgcccctgtgccagtggcctcctctgccagccacacagccacagtctg
gtatacatgtgcaagccagccttcgttggcagccatgaccacaatgaggagagccagctg
cccagggaggccctggatgactacgaagatgttggcttcataggggaggtgcgtcaggag
ctggaagacctggagcggagcctggcccaggagatggcatttgaggaggccacccctgtg
gattcactaggtggagagaagatttag

DBGET integrated database retrieval system