KEGG   Rattus norvegicus (rat): 171549Help
Entry
171549            CDS       T01003                                 

Gene name
Klc3, Klct
Definition
(RefSeq) kinesin light chain 3
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    171549 (Klc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171549 (Klc3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171549 (Klc3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     171549 (Klc3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171549 (Klc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_19 TPR_8 TPR_MalT TPR_17 ANAPC3 SNAP PPR TPR_16 GHL15 PV-1 YabA DUF3450 Tox-GHH TPR_4
Motif
Other DBs
NCBI-GeneID: 171549
NCBI-ProteinID: NP_612529
RGD: 621432
Ensembl: ENSRNOG00000018101
UniProt: Q68G30
Position
1q21
AA seq 505 aa AA seqDB search
MSVQVAAPGSTGLGPERLNPEELVRQTRQVVQGLEALRAEHHSLAGHLAEALAGPGPVAG
VELLEEKQQVVNHSLEAIELGLGEAQVLLALSAHVGVLEAEKQRLRAQARRLAQENTWLR
EELEETQRRLRASEEAVAQLEEEKSHLQFLGQLRQYDPPEESQRPDSPPRRDSLASLFPS
EEEEKKGPEAAGAAAAQQGGYEIPDRLRTLHNVVIQYASHVRYEVAIPLCRQALEDLVRS
SGHFHPDVPTMVDFLALVYRDQNKYKEATEFLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFQDVERHYARAL
SIYEALGGPQDPNVAKIKNNLASAYLKQNKYQQAEELYKEILSQEALPAPLGAPQGGTAG
EAQQQVLRRSSSFSKLRESIRRGSEKLVSRLRGESMAGAAGMKRAMSLNMLNVDGPRAAR
MQLSTQHLNEASRTLSASTQDLSPR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcaggtggcagcccctggaagcacagggctgggcccagaacgcctgaacccg
gaggagctggtgcggcagacgcgacaggttgtacagggactggaggccctgcgggccgag
caccatagtctggctgggcacttggcggaggccctggctggaccaggccctgtagcgggt
gtagaactgctggaagagaagcaacaggtggtgaaccactccctggaggccattgagctg
ggactgggtgaggcccaggtgctgctggccctgtctgcacacgtgggtgtgttggaggct
gagaagcagaggctacgggcacaggcacggaggctagcccaagagaacacatggcttcga
gaggagctggaggagacacagaggcgactgcgggccagtgaggaggctgtggcccagctg
gaagaggagaaaagccaccttcagttcctggggcagctgaggcagtatgacccgcccgag
gagagccagaggccggattccccgcctcgccgagacagcctggcttctctcttccccagt
gaagaggaggaaaagaaaggtcctgaggcagcaggagcagcagcagcgcagcagggtggc
tatgagatcccagatcgtctacggactctgcacaacgtggtgatccagtatgctagccac
gtccgctatgaggtggcaattccgctgtgtcgccaggcattggaggacctggtgcggagc
tcaggccacttccaccctgacgtacccaccatggtcgacttcttggcacttgtgtacagg
gaccagaacaagtacaaggaggccacggagtttcttcacgacgccctgcagatccgggaa
cagacgctgggtcctgaacaccctgcagtggccgccaccctcaacaacctggcagtcctt
tacggaaaacgtggccgttaccgggaggcagaacccctctgccagcgtgctctggagatc
cgtgagaaggtcctgggtgctgaccaccctgatgtggccaagcagctcaacaacctggcc
ctgctgtgccagaaccagggcaagtttcaggatgtggagcggcactatgcaagggccctg
agtatctacgaggccctggggggaccacaagacccaaatgtggctaagatcaagaacaac
ctggcctcggcctacctgaagcagaacaagtatcagcaggcagaggagctatacaaggag
atcctcagccaggaggccctgcctgccccgcttggagccccccagggaggcacagcaggt
gaagcacaacagcaggtcctacgcaggagcagttccttctctaagctcagagagtccatc
cggcgtggaagtgagaagctggtctcccgcctccgaggggagagcatggcaggggctgca
gggatgaagagagccatgtcactcaatatgctgaacgtcgatggtccaagggctgccagg
atgcagctctcaacccagcacctgaatgaggcctctcggaccctcagcgccagcacgcag
gatttgagcccgcgctaa

DBGET integrated database retrieval system