KEGG   Rattus norvegicus (rat): 171562
Entry
171562            CDS       T01003                                 

Gene name
Ero1a, Ero1l
Definition
(RefSeq) endoplasmic reticulum oxidoreductase 1 alpha
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    171562 (Ero1a)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     171562 (Ero1a)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 171562
NCBI-ProteinID: NP_612537
RGD: 621713
Ensembl: ENSRNOG00000006462
UniProt: Q8R4A1
Position
15p14
AA seq 464 aa
MGRAWGLLVGLLGVVWLLRLGHGEERRPETAAQRCFCQVSGYLDDCTCDVETIDKFNNYR
LFPRLQKLLESDYFRYYKVNLRKPCPFWNDINQCGRRDCAVKPCHSDEVPDGIKSASYKY
SKEANLLEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDSFCEVDDIQSPDAEYVDL
LLNPERYTGYKGPDAWRIWSVIYEENCFKPQTIQRPLASGQGKHKENTFYSWLEGLCVEK
RAFYRLISGLHASINVHLSARYLLQDNWLEKKWGHNVTEFQQRFDGVLTEGEGPRRLKNL
YFLYLIELRALSKVLPFFERPDFQLFTGNKVQDVENKELLLEILHEVKSFPLHFDENSFF
AGDKHEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIANM
PESGPSYEFQLTRQEIVSLFNAFGRISTSVRELENFRHLLQNVH
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggccgcgcctggggcttgctcgtcggactcttgggcgtcgtgtggctgctgcgcttg
ggccacggcgaggagcggcggccggagacagcggcacagcggtgtttctgtcaggttagt
ggttacctggatgactgtacctgtgatgtcgagaccatcgataagtttaataactacaga
cttttcccaagactacaaaagctccttgaaagtgactactttagatactacaaggtaaac
ttgaggaagccatgtcctttctggaatgacatcaaccaatgtggaagaagagactgtgct
gtcaaaccctgccattctgatgaagtccctgatggaattaagtctgcgagctacaagtat
tccaaggaagccaacctccttgaggagtgtgagcaggctgagcggctcggagcagtggac
gaatctctgagtgaggagacccagaaggctgttcttcagtggacgaaacacgatgattct
tcagacagcttctgtgaagttgatgacatacagtcccccgatgctgagtatgtggattta
ctccttaaccctgagcgctacacaggctacaaggggccggacgcttggaggatatggagt
gtcatctatgaagaaaactgctttaagccacagacaattcaaaggcctttggcttcgggg
caaggaaaacataaagagaacacattttacagctggctagaaggcctctgtgtagaaaag
agagcattctacaggcttatatctggcctacacgcaagcatcaatgtacatttgagtgca
aggtatcttttacaagataattggctggaaaagaaatggggtcataatgtcacagagttt
cagcagcgctttgatggggttttgacagaaggagaaggccccaggaggctgaagaacctg
tactttctttacctgatagagttaagggctctctctaaagtgcttccgtttttcgagcgc
ccagattttcagctcttcactggaaataaagttcaggatgtggaaaacaaagagttactt
ctggagattcttcatgaagtcaagtcatttcctttgcattttgatgagaattcttttttt
gcgggggataaacacgaagcacataagctaaaggaggacttccgcctacactttagaaac
atctcgaggatcatggactgcgtcggctgcttcaagtgccgcctgtggggcaagcttcag
actcagggtctgggcactgctctgaagatcttgttttctgaaaaactgatcgcaaatatg
ccggaaagcggacccagttatgaattccagctaaccagacaagaaatagtgtcgttgttc
aatgcatttggaaggatttccacaagtgtgagagaattagagaacttcagacacttgtta
cagaatgttcactga

DBGET integrated database retrieval system