KEGG   Rattus norvegicus (rat): 171569
Entry
171569            CDS       T01003                                 

Gene name
Spon2
Definition
(RefSeq) spondin 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Spond_N TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 171569
NCBI-ProteinID: NP_612542
RGD: 708584
Ensembl: ENSRNOG00000006033
UniProt: Q9WV75
Position
14q21
AA seq 330 aa
MENVSFSLDRTLWVFLLAMLGSTAGQPLGGESVCTARPLARYSITFTGKWSQTAFPKQYP
LFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEAAGEKLQSVH
AVFSAPAVPSGTGQTSAELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCEGGRWKEQVV
LDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRLKSLPPIAKVTF
VRLRQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGPCGKLGAKSR
TRYVRVQPANNGTPCPELEEEAECAPDNCV
NT seq 993 nt   +upstreamnt  +downstreamnt
atggaaaacgtgagtttttccctggacagaactctttgggtcttcctcctggccatgcta
ggctccaccgcaggccagccgctggggggagaatctgtctgcacagcccggcctctggct
agatacagcatcactttcactggcaagtggagccagacagcatttcccaagcagtatcct
ctgttccggccccctgcacagtggtcctctctgctgggggcagcacacagctctgactac
agcatgtggcggaagaatgagtacgtcagcaatgggctgagggacttcgctgagcgtggt
gaggcctgggcactgatgaaagagatcgaagcagcaggagagaagctccagagtgtgcac
gcggtattctcggctcccgccgtgcctagtggtaccgggcagacttctgcagagttagag
gtgcaccctaggcactcgctggtgtccttcgtggtacgcattgtccccagtccggactgg
tttgtgggcatcgacagtctggacctgtgcgagggaggccgctggaaggagcaggtggtc
cttgatctttacccacacgatgcagggacagacagtggcttcaccttctcctcccccaac
tttgcaaccatcccacaagacacagtgactgagataaccgcctcatcgcccagtcaccca
gccaactcattctactacccacgcctcaagtccttgccacccattgccaaagtgaccttc
gtgcggctacggcagagtcccagagcctttgccccaccttccctggacctggccagcaga
ggaaatgaaatcgttgacagcctctcagttccagagacaccgctggactgtgaagtttcc
ctgtggtcatcctggggactgtgcggagggccatgtggaaagttgggagccaagagcaga
actcgctatgtgcgtgttcagcctgctaacaatgggactccctgtcccgagcttgaagaa
gaggctgagtgtgccccagataactgtgtctaa

DBGET integrated database retrieval system