KEGG   Rattus norvegicus (rat): 171572Help
Entry
171572            CDS       T01003                                 

Gene name
Ttl
Definition
(RefSeq) tubulin tyrosine ligase
  KO
K06047  tubulin---tyrosine ligase [EC:6.3.2.25]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171572 (Ttl)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.25  tubulin---tyrosine ligase
     171572 (Ttl)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Other tubulin modification proteins
      171572 (Ttl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TTL ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 171572
NCBI-ProteinID: NP_612545
RGD: 621113
Ensembl: ENSRNOG00000018205
UniProt: Q9QXJ0
Position
3q36
AA seq 377 aa AA seqDB search
MYTFVVRQENSSVYAEVSRLLLATGYWKRLRRDNPRFNLMLGGRNRLPFGRLGHEPGLAQ
LVNYYRGADKLCRKASLVKLVKTSPELSESCSWFPESYVIHPTNLKTPVAPAQNGIQLPV
SNSRTDEREFFLASYNRKKEDGEGNVWIAKSSAGAKGEGILISSEASELLDFIDNQGQVH
VIQKYLEHPLLLEPGHRKFDIRSWVLVDHQYNIYLYREGVLRTASEPYHVDNFQDKTCHL
TNHCIQKEYSKNYGKYEEGNEMFFEEFNQYLTSALNITLENSILLQIKHIIRSCLMSVEP
AISTKHLPYQSFQLLGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAISSVFP
PPDTEQVPQQPAAFMKL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccttcgtggtgcgccaggagaatagcagcgtctacgccgaggtctcccggctg
ctgctggccaccggctactggaagaggctgcggcgggacaaccccaggttcaacctgatg
ctgggcggaaggaaccgactgcctttcgggagactaggacacgaacctgggctggcacag
ctggtgaactactacaggggggccgacaaactgtgccgcaaagcttccttagtgaagcta
gtcaagaccagtccggaactgtctgagtcctgctcatggttccccgagtcctatgtgatt
catccaactaacctcaagacgccagtcgctccagcgcagaatggcatccagcttccggtc
agtaactccaggacagatgagagagaattcttcttggcttcttataacagaaagaaagag
gacggggaaggcaacgtttggattgcaaagtcatcagctggtgccaaaggcgaaggcatc
ctcatctcctcagaggcgtcagagcttctggattttatagacaaccagggccaagtgcac
gtgatccagaaatacctcgagcaccctctgctcctcgagcccggtcaccgcaagtttgac
attcgaagctgggtcctggttgaccaccagtataacatctacctctacagagagggtgtg
cttcgaactgcttcagaaccatatcatgttgataacttccaagataagacctgccatctg
accaatcactgcattcagaaagagtactcaaagaactatggaaaatacgaagaagggaac
gaaatgttcttcgaagagttcaatcagtacctaacaagcgctctgaacattaccctagaa
aatagcatcttgctgcaaatcaaacacataataaggagctgcctcatgagcgtggagccc
gccatcagcaccaagcacctcccttaccagagcttccagctccttggctttgacttcatg
gtggatgaggagctgaaagtctggctcattgaggtcaacggtgcccctgcgtgtgcccag
aagctctatgcagaactgtgtcagggcatcgtggacatagccatatccagcgtcttccca
cccccagacacggagcaggtgccgcagcagccggctgctttcatgaagctgtga

DBGET integrated database retrieval system