KEGG   Rattus norvegicus (rat): 171575
Entry
171575            CDS       T01003                                 

Gene name
Dnase2
Definition
(RefSeq) deoxyribonuclease-2-alpha precursor
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171575 (Dnase2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     171575 (Dnase2)
SSDB
Motif
Pfam: DNase_II DUF1616
Other DBs
NCBI-GeneID: 171575
NCBI-ProteinID: NP_612548
RGD: 621457
Ensembl: ENSRNOG00000023830
UniProt: Q9QZK8
Position
19
AA seq 350 aa
MAAPSSLLLAALLWVPAEALSCYGDSGRPVDWFVVYKLPANSGSGDKPWKGLMYKYMDQN
SEGWQDGVGHIDSKDGAVGLTLQPLYQKNSSQLAFLLYNDQPPKSSSAQDSSSRGHTKGV
LLLDQEGGFWLVHSVPRFPSPASSGAYSWPPNARTYGQTLLCVSLPFSQFPGIGKQLTYT
YPLVYDHKLEGIFAQKLPDLEEVTKGHHVLREPWNSSVILTSRAGTTFQSFAKFGKFGDD
LYSGWLAAALGTNLQVQFWPNSPGILPSNCSGTHKILDVTETGFPGPSGPTFNATEDHSK
WCVAPEGPWVCVGDMNRNKRETHRGGGTLCTQVPALWKAFRSLVKACKPC
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcagcaccgagctcgctgctgttggctgcgctgctgtgggttcctgccgaagccctg
agctgctatggggactcggggcggcctgtggattggttcgtggtatacaagctgccggct
aacagcgggtctggggataagccatggaagggtctgatgtataaatacatggaccagaac
tccgagggttggcaagacggtgtagggcacatcgacagcaaggacggagccgtgggcctc
accctgcagccgttgtaccaaaagaactccagtcagctggcctttctactctacaacgac
caacctcccaaatccagctcagctcaggactcttccagccgtgggcatacgaagggtgtc
ctgctcctggaccaagaagggggcttctggctggtccacagtgtgcctcgcttcccatcc
cctgcatcctctggtgcatacagctggcctccgaacgctcggacctacggccagacccta
ctctgtgtgtcccttcccttcagtcagtttccagggattggcaagcaactaacctatacc
taccccctagtctatgaccacaagctggaaggtatctttgctcaaaaattacctgaccta
gaagaggtgaccaagggccaccatgtcctccgtgagccctggaatagtagtgtaattctc
acttctcgagctgggaccaccttccagagctttgccaaatttggaaaatttggagatgac
ctgtactccggctggctggcagcagcccttggcaccaacctacaggtccagttctggcca
aattctccaggcatcctgccttccaactgctctgggacccataaaattctggatgtgact
gagacaggattccctggcccatctggaccgactttcaacgccacagaggatcactccaaa
tggtgtgtggcccccgaagggccctgggtctgtgtgggtgacatgaatcggaacaaaaga
gagacacaccgcggtgggggcacactgtgcacccaagtgcctgccctctggaaggccttc
cggtccttggtgaaagcctgtaagccctgttaa

KEGG   Rattus norvegicus (rat): 59296
Entry
59296             CDS       T01003                                 

Gene name
Dnase2b
Definition
(RefSeq) deoxyribonuclease-2-beta precursor
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    59296 (Dnase2b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     59296 (Dnase2b)
SSDB
Motif
Pfam: DNase_II
Other DBs
NCBI-GeneID: 59296
NCBI-ProteinID: NP_067696
RGD: 70901
Ensembl: ENSRNOG00000016262
UniProt: Q9QZK9
Position
2
AA seq 356 aa
MTAQPLKAALPLLFVALSGVLGTPVISCINEDGKAVDWFAFYKLPRRTSRGGTGMGLDYL
YLDSTMRTWSKSHHLINSSRSSLGRTLEQLYEAHNAKNDTAYLIYNDAVPASVNYSGNYG
HAKGLLVWNRVQGFWLIHSIPKFPPVPEKGYEYPNSGRQYAQSGLCITLKYSQYETIDSQ
LLVFQPNIYSCFIPNIFRWELIHMPQMCAKSSASKIPSRRLTVLQSAQGLNFLHFAKSTF
YTDDIFAAWIAQKLKVHLLVESWQRKNHELPSNCSLPYHVYNIKAIRGPLQSDFPSHHDH
SKWCVSTKDSQARWTCIGDLNRSPHQALRSGGFICSKNRYIYQSFDRLVSHYASCN
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgacagcccagcctctaaaagcagctcttcctttgctcttcgttgccctgtccggagtc
ctggggacaccagtaatctcgtgcataaacgaagatggtaaagccgtggactggtttgcc
ttttataagttacccagaaggaccagcagaggaggtacagggatggggctggattacctg
tacctggactccacaatgagaacctggagcaagagccaccacctgattaacagcagcagg
agctccctgggaaggaccctggagcagctgtatgaagcacacaatgccaagaatgacaca
gcctatctgatatacaatgacgctgtccctgcatctgtgaattacagcggaaattacggg
catgccaaaggtctgctggtatggaacagagtgcaggggttctggctgattcattctatt
cccaagtttcccccagttccggaaaaaggctatgaatacccaaactcggggaggcaatat
gcacaaagtggcctctgcatcactctcaaatacagccagtatgagacaatagattctcag
ctcttggtcttccagccaaacatctacagctgtttcatcccaaacatctttcgctgggaa
ctcatccacatgcctcagatgtgtgccaagtccagtgcctcaaagatccctagccggcgc
ctcactgtacttcagtcagcccagggtctaaacttcctccattttgcgaaatcaactttt
tatactgatgacatctttgcagcctggatagctcaaaagctgaaggtgcatttgctggta
gaatcctggcagcgaaagaaccacgagcttccttcaaactgttccctgccttaccatgtc
tacaacatcaaggccattcggggacctctgcagtccgacttcccttctcatcacgaccat
tccaaatggtgtgtttccacaaaggactctcaggctcgctggacctgtattggagaccta
aatcggagcccacatcaagccttgagaagtggaggatttatctgttcgaagaatcggtac
atttaccagtcatttgataggttagtttcccattatgcctcctgtaactaa

DBGET integrated database retrieval system