KEGG   Rattus norvegicus (rat): 191569Help
Entry
191569            CDS       T01003                                 

Gene name
Pde9a
Definition
(RefSeq) phosphodiesterase 9A
  KO
K13761  high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9 [EC:3.1.4.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    191569 (Pde9a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     191569 (Pde9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I AAA_lid_10 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 191569
NCBI-ProteinID: NP_612552
RGD: 621035
Ensembl: ENSRNOG00000001174
UniProt: Q8QZV1
Position
20p12
AA seq 534 aa AA seqDB search
MGAGSSSYRPKAIYLDIDGRIQKVVFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAVKQVSEREELVQGVLAQVAEQFSRAFKINELKAEVANH
LAMLEKRVELEGLKVVEIEKCKSDIKKMREELAARNNRTNCPCKYSFLDNKKLTPRRDVP
TYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLC
VHDNYRSNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNN
TYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLIL
ATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLL
EEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPIVEETMLR
PLWESREHYEELKQLDDAMKELQKKTENLTSGATENAPEKTRDAKDNEDRSPPN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggggccggctcctcaagctaccggcccaaggccatctacctggacatcgatggacgc
atccagaaggtggttttcagcaagtattgtaactccagtgacatcatggacctgttctgt
atcgccaccggcctgccacggaataccaccatctcccttctgaccacagacgacgccatg
gtctccatcgatcccaccatgcctgcgaattcagagcgaactccctacaaggtgagacct
gtggctgtcaagcaagtgtctgaaagagaagaactcgtccagggtgtgctggcccaagtg
gcggaacaattctccagagcgtttaagatcaacgagctgaaagctgaagttgcgaatcac
ctggccatgctggagaaacgggtggaattggaaggactcaaagtggtggagatcgaaaaa
tgcaagagtgatattaaaaagatgcgggaggagctggcagctagaaacaacaggaccaac
tgtccctgtaaatacagttttttggataacaagaagttgacacctcgacgtgatgtcccc
acttaccccaagtacctgctctccccagaaaccattgaagccctacggaagcccaccttt
gatgtctggctttgggaacccaatgagatgctgagctgtttagagcatatgtaccatgac
cttggtctggtcagggacttcagcatcaacccaatcacactccgcaggtggctgctctgt
gtgcatgacaactacaggagcaaccccttccacaacttccggcactgcttctgtgtgaca
cagatgatgtacagcatggtctggctctgtggcctccaggagaagttttcccagatggac
atcttggtcctgatgaccgcagccatctgccatgacctggaccacccagggtacaacaac
acataccagatcaacgcccgcacggaactagcggtgcgctacaacgacatctcgccgctg
gagaaccaccattgcgccatcgccttccagatcctggcgagacccgagtgcaacatcttc
gccagcgtgccgcctgagggcttcaggcagatcaggcaggggatgatcacgttgatcttg
gccaccgacatggcaaggcacgctgaaattatggattctttcaaagaaaaaatggagaat
tttgactacagcaatgaggagcatctgaccctgctgaagatgatcctcataaaatgctgt
gacatctccaatgaggtccgtcccatggaggtggcagaaccgtgggtggactgtttactg
gaagaatattttatgcagagtgaccgcgagaagtccgaaggccttcctgtggccccattc
atggaccgagacaaagtgaccaaagcgacagcccaaattgggttcatcaagtttgtcctg
atcccaatgtttgaaacagtgaccaagctcttccccattgtcgaggagaccatgctgcgg
cctctctgggagtcccgagaacactacgaggaactgaagcagctggacgacgccatgaag
gagctgcagaagaagacggagaacttaacatctggggccacggaaaacgccccagagaag
accagagatgcgaaagacaatgaagaccgttcgcctccaaactga

DBGET integrated database retrieval system