KEGG   Rattus norvegicus (rat): 191574Help
Entry
191574            CDS       T01003                                 

Gene name
Akr1c14, Akr1c9
Definition
(RefSeq) aldo-keto reductase family 1, member C14
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 191574
NCBI-ProteinID: NP_612556
RGD: 708361
Ensembl: ENSRNOG00000017672
UniProt: P23457
Structure
PDB: 

Position
17q12.2
AA seq 322 aa AA seqDB search
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEE
VGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPM
ALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKP
GLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPV
LCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLN
RNFRYNNAKYFDDHPNHPFTDE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggattccatatctctgcgtgtagcactaaatgatggtaacttcattcctgtactgggg
tttggaaccactgtgcctgagaaggttgctaaggatgaagttatcaaggctactaaaata
gctatagataatggattccgccattttgactctgcttatttgtacgaagtagaagaggaa
gtgggccaagccattagaagcaagattgaagacggcactgtgaagagagaagatatattc
tatacttcaaagctttggagcactttccatagaccagagctggtccgaacttgcttggaa
aagacactgaaaagcactcaactggactatgtggatctttatattattcatttcccaatg
gctttgcagcctggagatatatttttcccacgagatgagcatggaaaactattgtttgaa
acagtggatatctgtgacacatgggaggccatggagaagtgtaaggatgcaggattggcc
aagtctattggggtgtccaactttaactgcaggcagctggagaggattctgaataagcca
gggctcaaatacaagcctgtgtgcaaccaggtggaatgtcacctttatctcaaccagagc
aaaatgctggactattgtaagtcaaaagacatcattctggtttcctactgcacgctggga
agttcacgagacaaaacatgggtggatcagaaaagtccagttctcctagatgatccagtt
ctttgtgccatagcaaagaagtacaagcaaaccccagccctagttgcccttcgctaccag
ctgcagcgtggggttgtgcccctgatcaggagtttcaacgcgaagcggatcaaagagcta
acacaggtttttgaattccagttggcttcagaggacatgaaagccctggatggcttgaac
agaaatttcagatacaacaatgcaaaatattttgatgaccatcccaatcatccatttact
gatgaatag

DBGET integrated database retrieval system