KEGG   Rattus norvegicus (rat): 192152Help
Entry
192152            CDS       T01003                                 

Gene name
Tgoln2, Tgn38, Tgoln1, Ttgn1
Definition
(RefSeq) trans-golgi network protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: KCT2 UCR_TM
Motif
Other DBs
NCBI-GeneID: 192152
NCBI-ProteinID: NP_620195
RGD: 620445
Ensembl: ENSRNOG00000014617
UniProt: P19814
Position
4q31
AA seq 357 aa AA seqDB search
MQFLVALLLLSVAVARALPSASKPNNTSSENNPPIQPSTPLPPGVDISQQVKTNRPTDQR
LESDKEGQDKTVARTSASVSSGVESATNLNLDDSKKHPETADAKLKETLQQLLPVDPKQE
KSGQKFTKDSGSPTGGDSDNTTGGDSNKTTGVDSDKTSGGDSNKPTGSDNDKPTGGDSNK
PTSKVPSNTETPKIDKVQLTEKGQKPTLISKTESGEKLAGDSDFSLKPEKGDKSSEPTED
VETKEIEEGDTEPEEGSPLEEENEKVLGPSSSENQEGTLTDSMKDEKDDHYKDNSGNTSA
ESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKVTRRPKASDYQRLNLKL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcctggttgcgttgctcctgctgagtgtcgcggtggcgagagctctgccatcc
gcttctaagccaaacaacacatcaagtgaaaataatcctccgattcaaccttccacgccc
ctgcctcctggggttgatatttctcaacaggtaaagactaacagaccgactgatcagagg
ctggagtcggataaagaaggccaggacaagacggtggctaggacttcggcatcagtttcc
agtggggtggaatctgcgaccaatctcaatttggatgattccaaaaagcaccccgaaaca
gcagatgccaaattgaaggaaactttgcagcagcttttgcctgtggaccccaaacaggaa
aagtcaggtcagaagtttacaaaagattcaggcagccccacaggaggtgattccgacaat
accacaggaggtgattctaacaagaccacaggagttgattctgacaagacatcaggaggt
gattctaacaagcccacaggaagtgataatgacaagcccacaggaggtgattctaacaag
cccacctccaaagtcccctccaatacagagactccaaaaattgacaaagtccagctaact
gaaaaaggacagaaaccaacacttatttccaaaactgaatctggggaaaaactggcaggg
gactctgacttctctttaaagccagagaaaggagataagtcttcagagcctactgaagat
gtggaaaccaaggagattgaagagggtgatacagagcccgaagaaggttcaccacttgaa
gaagagaatgaaaaggtgttgggcccttcctccagtgagaaccaagaggggacacttaca
gattctatgaaggatgagaaggatgaccattataaggacaattctggaaacaccagtgca
gaaagcagccacttctttgcttatctggtgaccgctgctgttcttgttgctgtcctctat
attgcttaccacaacaaacgaaagattattgcttttgccctggaaggaaaaagatccaaa
gtcactcggaggccaaaggccagtgactaccaacgtttgaacctaaagctttga

DBGET integrated database retrieval system