KEGG   Rattus norvegicus (rat): 192154Help
Entry
192154            CDS       T01003                                 

Gene name
Hip1
Definition
(RefSeq) huntingtin interacting protein 1
  KO
K04559  huntingtin interacting protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    192154 (Hip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192154 (Hip1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    192154 (Hip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANTH I_LWEQ HIP1_clath_bdg
Motif
Other DBs
NCBI-GeneID: 192154
NCBI-ProteinID: NP_001093945
RGD: 620305
Ensembl: ENSRNOG00000001448
UniProt: G3V8Y8
Position
12q12
AA seq 1030 aa AA seqDB search
MDRMASSMKQVPNPLPKVLSRRGVGAGMEAAERESFERTQTVSVNKAINTQEVAVKEKHA
RTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNE
LSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNN
FFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTV
KLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAEVSSPDSEPVLEKDDLMDMDASQQSLFDNKFDDIFGSSLSSDPF
NFNNQNGVNKDEKDHLIERLYREISGLTGQLDNVKIESQRAMLQLKGRVSELEAELAEQQ
HLGRQATDDCEFLRTELDELKRQREDTEKAQRSLTEIEKKAQANEQRYSKLKEKYSELVQ
NHADLLRKNAEVTKQVSVARQAQVDLEREKKELADSFARTQEQQDVLETLKHELATSRQE
LQVLHGNLETSAQSEAKWLTQIAELEKEQGSLATAAAQREEEFSALRDQLESTQLKLAGA
QDSMCQQIKDQRRILLAGARKAAELEIQEALGQLEEPALLISCAGATDHLLSKVNSVSSC
LEQLEKSRSQYLACPEEISELLHSITLLGHLTSDTIIQGTATSLRAPPESADSLTEACRQ
YGRETLAYLSSLEEEGAMEKADTTAIANCLGKIKTIGEELLPRGLDIKQEELGDLVDKEM
AATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKE
IVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCS
HEIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMD
FSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAGVAEGWEEGTEASPS
AVQEAVPDKE
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggaccggatggccagctccatgaagcaggtacccaacccgctgcccaaagtgttgagc
cggcgcggggttggtgctgggatggaggctgcggagcgcgagagcttcgagcggactcag
acggtcagcgtcaataaggccattaatacgcaggaagtggccgtgaaggaaaaacatgcc
aggacgtgtattctgggcacccaccatgagaaaggggcgcagaccttctggtctgtggtc
aaccgactgcctctctccagcaacgccatgctgtgctggaagttctgccacgtgttccac
aaactccttcgagacggacatccgaacgtgctgaaagactctctcagatacaaaaatgag
ttaagcgacatgagcaggatgtggggccacctgagtgaggggtatggacagctctgcagc
atctacctcaaactgctgagaacaaggatggagtaccacaccaaaaatcccaggttccca
ggtaacctccagatgagcgaccggcagctggatgaagctggggaaagtgatgttaacaac
tttttccagctcacagtggagatgtttgattacctggagtgcgaactgaacctctttcaa
actgtgttcaactccttggacatgtcccgctcagtgtccgtgaccacagctggccagtgc
cgcctcgccccgctcatccaggtcatcctggactgcagtcacctctatgactacactgtc
aagctgctcttcaagctccactcctgtcttccagctgacaccctgcagggccaccgagac
cgcttcatggagcagttcacaaagttgaaagatctgtttcagcgctccagcaaccttcag
tacttcaagcggctcattcagatcccccagttgcctgagaatccacccaacttcctacga
gcctcggccctgtccgagcacatcagtcctgtggtggtgatcccggctgaggtgtcgtct
ccagacagtgagcccgtcctggagaaggatgacctcatggacatggatgcctcccagcag
agtttgtttgacaacaagtttgatgacatcttcggcagctcgttgagcagtgaccccttc
aatttcaacaatcaaaatggcgtgaacaaggatgagaaggaccacttgattgaacgcctc
tacagagagatcagtggactgacaggacagctggacaacgtgaagattgagagccagcgg
gccatgctgcagctgaagggtcgcgtgagtgagctggaagcagagctggccgagcagcag
cacctgggacggcaggctacggatgactgcgagttcctgcgcacggagctggatgaactg
aagaggcagcgagaggacactgagaaggcgcagcgcagcctgactgagatagaaaaaaag
gcccaggccaatgaacagcggtatagcaagttaaaagagaagtacagtgaactggtgcag
aaccatgctgatctgctgcggaagaatgcagaggtgaccaagcaggtgtctgtggcccgg
caagcccaggtggatttggaaagagagaaaaaagaactagcggattcctttgcacgtact
caagagcaacaggatgttctagagaccctgaagcacgaactggccaccagcaggcaagag
ctgcaggtcctccatggcaacctggaaacctctgcccagtctgaggcgaaatggctaacg
cagatcgcggagctggagaaggaacaaggcagtttggcgacagccgccgctcaaagagag
gaagagttctcagccctccgagaccaactggaaagcacccagctcaaactggctggtgcc
caggattccatgtgtcagcagataaaggaccagaggagaatcctcttggcaggggccagg
aaggctgcggagctcgagatacaggaggccctgggccagcttgaagagcctgccctcctc
atcagctgtgcaggagccacagatcatcttctctccaaagtcaactccgtttccagctgc
ctcgagcaactggaaaagagccgcagccagtatctggcctgcccagaagagatcagtgag
cttctgcactcaataaccctgcttggccacttgaccagtgacaccatcattcaggggact
gccaccagcctccgggccccaccagagtcagccgactctctgacggaggcctgtaggcag
tatggcagagaaactctggcctatctgtcctccctagaggaagagggggccatggaaaaa
gctgacaccacagccatagcgaactgcctcggcaagatcaagaccattggcgaggaactg
ctgcccaggggcttggacatcaagcaggaagagctgggtgacctggtggacaaggagatg
gcagccacttcagctgccattgaagctgccaccacccggatagaggaaattctcagtaag
tcccgagcaggagacacgggagtcaagttggaggtgaacgagaggatccttggctcctgt
accagcctgatgcaagctatcaaggtgctcgttgtggcctccaaggacctccagaaggag
atagtggaaagcggcaggggtaccgcatcccctaaagaattttacgccaagaactctcgg
tggacagaagggctcatatctgcctccaaagctgttggttggggagctaccatcatggtg
gatgctgctgaccttgtggtccaaggcaaagggaagttcgaggagctgatggtgtgctcg
catgagattgccgctagcacagcccagcttgtggctgcatccaaggtgaaagcgaacaag
ggcagcctcaatctgacccagctgcagcaggcctctcggggagtgaaccaggccacggcc
gctgtggtggcctcaaccatttccggcaaatctcaaattgaggaaacagacagtatggac
ttctcaagcatgacactgacccagatcaagcgccaggaaatggattcccaggttagggtg
ctggagctagaaaacgacctgcagaaggagcgccagaaactaggagagcttcggaaaaaa
cactacgagctggctggtgttgctgagggctgggaagaagggacagaagcatcaccttct
gctgttcaagaagcggtgccggacaaagagtag

DBGET integrated database retrieval system