KEGG   Rattus norvegicus (rat): 192177Help
Entry
192177            CDS       T01003                                 

Gene name
Unc13d, Munc13-4, Unc13h4
Definition
(RefSeq) unc-13 homolog D
  KO
K19728  protein unc-13 D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192177 (Unc13d)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    192177 (Unc13d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 Membr_traf_MHD DUF4389
Motif
Other DBs
NCBI-GeneID: 192177
NCBI-ProteinID: NP_620199
RGD: 628593
Ensembl: ENSRNOG00000007439
UniProt: Q9R189
Position
10q32.1
AA seq 1088 aa AA seqDB search
MATHLSHPQRRPPLLRQAVKIRRRRVRDLQDPPPQATPEVQVQSHHFSPEERDLLYEEAL
YTVLHRLGQPEPNHVKEASELLCYLQEAFQVQPEEHQQMLQRVRELEKPIFCLKATVKQA
KGILGKDVSGFSDPYCLLGIEQKVGVPEGSPVSRRRQKAVVRHTIPEEETHRTQVKTQTL
NPVWDETFILEFEDITNASFHLDMWDLDTVESVRHKLGELTDLHGLRRIFKEARKDKGQD
DFLGNVMLRLQDLRCREDQWFPLEPCTETYPDRGQCHLQFQFIHKRRATVASRSQPSYTV
HFHLLQQLVSHEVTQHQAGGTSWGRIAESQAVTILFLHATQKDLSDFHQSMAQWLAYSRL
YQSLEFPSSCLLHPITSIEYQWIQGRLKAEQREELATSFTSLLAYGLSLIRKFRSVFPLS
VSDSPSRLQSLLRVLVQMCKMKAFGELCPDSAPLPQLVSEALRMGTVEWFHLMQQHHQPM
VQGILEAGKALLSLVQDVMGDLYQCRRTWNKIFHNVLKIDLFTMAFLELQWLVAKRVQDH
TAAVGDLVSPDVGESLFQLYVSLREFCQLGPSDSHEVLALDGFHRWFQSAIPSWLQRTYS
VALERVQRAVQMDSLVPLGELTKHSTSAVDLSTCFAQISHTARQLDWPDPEEAFMITVKF
VEDTCRLALVYCSLIKARARELSAVQKDQSQAADMLCVVVNNVERLRLIIDKLPTQLAWE
ALEQRVGAVLEQGQLQNTLHTQLQGALAGLGHEIRTGVRTLAEQLEVGIATHIQKLIDAK
GSILPEDAILPLMKFLEVKLCYMNTNLVQENFSSLLTLLWTHTLTVLVEAAASHRNSSLA
SSRLKVALQNLEICFHAEGCGLPPEALHTDTFLALQSDLELQAASSRELIQKYFRSRIQQ
QAETTSERLGAVTVKASYRASEQKLHVELLSASSLLPLDSNGSSDPFVQLTLEPRHEFPE
LAPRETQKHKKELHPLFDETFEFLVPAEPCQKDGACLLLTVLDHDRLGADDLEGEAFLPL
CRVPGLTGCVEPGEAPQMRLPLTYPAPNGDPILRLLESRKGDREAQAFVKLRRQRAKQAS
QHAPATEP
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacacctctcccacccccagcggcgccctccactcttgcgccaggccgtcaag
ataaggcgccgcagggtcagagacctgcaggatccaccgccccaagccaccccggaggtc
caggttcaatcccaccacttctccccggaggagcgggacctgctgtatgaggaagccctc
tataccgtcctgcaccgcctgggtcagccagagcccaaccatgtgaaggaggcctcggaa
ctgctgtgctatctgcaggaggctttccaggtgcagcccgaggagcaccagcagatgcta
cagcgtgtcagggagcttgagaagccaatattttgtctgaaggcaacagtgaaacaggcc
aagggcattctgggcaaggatgtcagcgggttcagcgacccctattgcctgctgggcatc
gagcagaaggttggtgtgccggagggcagccctgtgtcccggcgtcggcagaaggccgtg
gtgaggcacaccatccctgaagaggagacccatcgcacccaagtcaagacccagacactt
aatcccgtctgggacgagacctttatcttggagtttgaggatataactaacgcaagcttt
cacctggacatgtgggacctggacactgtggagtctgtcaggcacaagctcggggagctc
acagacctgcatgggctcaggaggatctttaaagaagctcggaaggataaaggccaggac
gactttctggggaatgtgatgctaagattgcaggacctgcgctgccgagaggatcagtgg
ttcccgctagagccctgcacagagacctacccagaccgcggccagtgtcacctgcagttc
caattcattcacaagcggagagccacggtggccagccgctcccagcccagctacactgta
cactttcacctactgcagcagctggtgtcccatgaagtcacacagcaccaggccggcggt
acctcctggggacgcatcgctgagtcccaggccgtcaccatcctctttctccacgccacc
cagaaggacctgtcagacttccaccagtccatggcgcagtggttggcctacagccgcctc
taccagagcctggagttccctagcagctgcctcctgcaccccatcaccagcatagagtac
cagtggatccagggccgactcaaagcggaacagcgggaggagttggccacctccttcaca
tccctgttggcctatggcctctccctcatccggaagttccgctccgtctttcccctgtct
gtctctgactccccgtccaggctgcagtccctcctcagagtcttggtccagatgtgcaag
atgaaggcctttggagaactgtgcccagacagtgccccactgccccagctggtttccgaa
gccctgcggatgggcacagttgaatggtttcacctgatgcagcaacaccaccagccgatg
gtacagggcatcttggaggctggcaaggccttgctgagcctggtacaggacgttatgggt
gatctgtaccagtgccgtcgcacatggaacaagatttttcacaatgtcctcaagatagac
ctgttcaccatggccttcctggagctgcaatggctggtggccaagagggtacaggaccac
acggcggcggtcggcgaccttgtttctccagatgttggagagagtctgtttcagctctat
gtcagcctgagggagttctgccagctgggcccctcagacagccatgaagtcctggccctg
gatggtttccaccgctggtttcagtcagccatcccttcctggctgcagaggacctatagc
gttgccctggagcgggtgcagcgagccgtacagatggactcgctggtacccctgggtgaa
ctgaccaagcatagcacttctgctgtggatctgtctacctgctttgcccaaattagccac
actgcccggcagctggactggccagacccagaggaggccttcatgatcacggtcaagttc
gtggaggacacctgccggctggccctggtctactgcagccttataaaggcccgggcccga
gagctgtctgcggttcagaaggaccagagccaggcagctgacatgctgtgcgtggtggta
aataatgtggagcgactacggttgatcatcgacaagctgcccacccaactggcatgggag
gcattggagcagcgggtcggggctgtgctggagcaggggcagctgcagaacacgctacac
actcagctgcagggcgccttggccgggctgggccacgagatccgtaccggtgtccgtact
ctggcagagcagttggaagtgggcattgccacacacatccagaagctcatcgatgccaag
gggtcgattctgcctgaggatgccattctgcccctgatgaaattcctggaggtgaagctt
tgttacatgaacaccaacctggtccaggagaacttcagcagcctcctgactctactgtgg
acccacacacttaccgtgctggtggaggcggcggcttcccatcgtaactcgtcactggct
tctagcaggctgaaggtcgccctccagaacctggagatctgcttccatgctgagggctgt
ggtctaccaccagaggccctgcacacagacaccttcctggctctgcagagcgacctggag
ctgcaggcagcctccagccgggagctcatccagaagtacttccgtagccggatccaacag
caggcggaaaccacttctgagaggctgggtgcagtcacggtcaaggcgtcctatcgagcc
tctgagcagaagctgcacgtggagctgctcagtgcctccagcctgctgccccttgactcc
aatggttccagtgacccctttgttcagctgacactggaacccagacatgaattccctgag
ctggctccccgggagacccagaagcacaagaaggaacttcacccgctctttgatgagacc
tttgaattcctggtgcctgctgagccgtgccaaaaagacggggcgtgcctcctgctcact
gtgctggaccacgacaggctgggagctgatgacctggagggagaggccttcttaccgctc
tgcagggtacctggactgacaggctgtgtggagcctggcgaagcacctcagatgcgcctg
cctctcacataccctgcacccaatggggatccgattttacggctgctggagagccggaag
ggtgatcgcgaggcccaggcctttgtgaagctgaggaggcagcgggccaagcaggcctcc
cagcatgcccccgcaacagagccatag

DBGET integrated database retrieval system