KEGG   Rattus norvegicus (rat): 192181
Entry
192181            CDS       T01003                                 

Gene name
Podxl, PC, PCLP-1, podocalyxin
Definition
(RefSeq) podocalyxin-like
  KO
K06817  podocalyxin-like
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    192181 (Podxl)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 192181
NCBI-ProteinID: NP_620203
RGD: 621878
Ensembl: ENSRNOG00000012495
UniProt: Q9WTQ2
Position
4q22
AA seq 485 aa
MRPTLALSALLLLQLLLLSTPSLSQDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSV
QPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSS
DKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSA
SVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTE
EFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPN
ERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWD
DLTEAGVIDIHLGKEGPPEVNEDRFSLPLIITIVCMASFLLLVAALYGCCHQRISQRKDQ
QRLTEELQTVENGYHDNPTLEVMETPSEMQEKKVVNLNGELGDSWIVPLDNLTKEDLDEE
EDTHL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgcgccccactctggcgctctccgcgctgctgttgctgcagctgctgttactgtcgact
ccatctctctcccaggataatggaaataagactgacacatctgatataactagcattgac
cagaaccaagacaaaccagcgacaaaccagccaagcaatgctacacctaaaagctcagtc
caacctccaacaccgacatctatttcaacctcctccccagaccccaaggccactcaaagc
agtaacagttcagttacaactaccagtgactccaccactgacaggacaagctcttccact
agcactgtccccactactagcaacagtgggcagacagtctcctctggaggcaagagcagt
gacaaaattaccacagccctaccaaccactttgggaccagtcaacgcctcttctcaacct
actgacctgaatacctcgacaaagcttccttctacccccacaacaaatagcacagcaagc
cctcaccagcctgtgagccactctgagggacagcacaccactgttcagagcagctctgct
tctgtgtccagctctgacaacactacgctgttgtggatacttactacatccaaaccgaca
ggcacctctgaaggcactcagcccatcgctatctcgacgccaggcatcaccacaccggtc
tccacaccactacagcctacggggtctccagggggaactgagtcggtgcctacgaccgaa
gaattcacacactccacttctagttggactccagtggtctctcaaggcccgagcacaccc
tcttccacctggacgtctgggagttacaagctaaaatgtgatcctgccataaagccccac
gaggaactcctcattctgaacctcacaagagacagcttttgtaaggggagccctccaaat
gaaagattcttggaactgctgtgtcactcagccaaagcctccttcaagccagctgaggat
tcgtgtgctctggagctggcccccattctagacaaccaggcggtggcagtgaagagaatc
gttattgagacgaagctttctcctaaggctgtgtttgaactgctgaaggacaaatgggac
gacctgacagaggctggagtcatcgacattcatctggggaaggaaggacctccagaagtc
aacgaggaccgcttcagccttcctctcatcatcaccatcgtctgcatggcatccttcctg
ctcctcgttgctgccctctacggctgctgtcaccagcggatctcccagaggaaggaccaa
caacgactcacagaggagctgcagacagtagagaatggttaccatgacaacccaaccttg
gaagtgatggagactccttctgagatgcaggagaagaaggtggtcaacctcaacggggag
ctgggagacagttggatcgtccctctggacaacttgaccaaggaggacctagatgaggag
gaagatacacacctctga

DBGET integrated database retrieval system