KEGG   Rattus norvegicus (rat): 192205
Entry
192205            CDS       T01003                                 

Gene name
Prok1
Definition
(RefSeq) prokineticin 1
  KO
K24191  prokineticin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    192205 (Prok1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   192205 (Prok1)
SSDB
Motif
Pfam: Prokineticin
Other DBs
NCBI-GeneID: 192205
NCBI-ProteinID: NP_620206
RGD: 620898
Ensembl: ENSRNOG00000018201
UniProt: Q8R414
Position
2q34
AA seq 105 aa
MRGAVQVFIMLLLATVSDCAVITGACERDVQCGAGTCCAISLWLRGLRLCTPLGREGEEC
HPGSHKIPFFRKRQHHTCPCSPSLLCSRFPDGRYRCSQDLKNVNF
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagaggtgctgtgcaagtcttcatcatgctccttctagcaactgtctctgactgtgcg
gtgatcacaggggcctgtgaacgagatgtccagtgtggggctggcacctgctgtgctatc
agcctgtggctgcggggcctgaggctgtgtacccctctggggcgggaaggagaggagtgc
caccctggaagccacaagatccctttctttaggaaacgccaacaccatacctgtccctgt
tcacccagcctgctgtgctccaggttcccagatggcaggtaccgctgctcccaggacttg
aagaatgtcaacttttag

DBGET integrated database retrieval system