KEGG   Rattus norvegicus (rat): 192208
Entry
192208            CDS       T01003                                 

Gene name
Slc38a5, SN2
Definition
(RefSeq) solute carrier family 38, member 5
  KO
K14992  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    192208 (Slc38a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    192208 (Slc38a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   192208 (Slc38a5)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 192208
NCBI-ProteinID: NP_620209
RGD: 620702
Ensembl: ENSRNOG00000027767
UniProt: A2VCW5
Position
Xq12
AA seq 471 aa
MEMQEPKMNGTLSTGAAAGYRQEREGFLPTTHGPAPGRKPVQFLDFEGKTSFGMSVFNLS
NAIMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCASVVGIRAYEQLGQRA
FGPAGKVVVAIIICLHNVGAMSSYLFIIKSELPLVIGTFLHMDPEGDWFLKGNLLIILVS
LLIILPLALMKHLGYLGYTSSLSLTCMLFFLISVIYKKFQLGCVVSHNDTVVESEPAPLQ
AFNSSCEAKLFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCCPTQRRMQAVANMSIGAM
FIMYGLTATFGYLTFYSTVKAEMLEMYTQEDLLILCVRLAVLLAVTLTVPVVLFPIRRAL
QQLLFPSKAFSWPRHVAIALILLNLVNILVICVPTIRDIFGFIGSTSAPSLIFILPSVFY
LRIVPADMEPLFSWPKIQALCFGVLGVLFMAISLGFMFANWATGQSRMSGH
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggaaatgcaggaaccaaagatgaacggaaccctctctacgggtgctgctgcgggctac
agacaggaacgcgaaggcttcctgcccaccacccatggccctgctccagggaggaaacct
gtccaattcttggatttcgaggggaagacatcattcggaatgtcagtgttcaaccttagc
aatgccatcatggggagtggcatcctggggctcgcctacgccatggcccacactggagtc
atcttcttcttggccctcttgctgtgcattgccctcctgtcttcttactctatccacctc
ctgctgacctgcgccagtgttgtaggaatccgcgcctatgagcagctgggacagagggca
tttggacctgccgggaaagtagtggtggccattatcatctgtctgcacaatgttggcgct
atgtccagttacctgttcatcatcaaatctgaactgcccctggttattggcaccttcctg
cacatggaccctgagggggactggttcttgaagggaaacctcctcatcatcctggttagc
ttgttaatcatcttgcctctggctctcatgaaacatctgggctacttggggtatacaagc
agcctctctctgacctgcatgctgtttttccttatttcagtcatctataagaagttccag
cttggctgtgttgtgagccacaatgacacagtagtggagagtgaaccagctcccttgcag
gcgtttaatagcagctgtgaggccaagctcttcacagttgactcacagatgtcttacaca
gtgcctattatggcttttgcctttgtctgccaccctgaggtgctgcccatttacacggaa
ctttgctgccctactcagcgcaggatgcaagctgtggccaacatgtccatcggggctatg
ttcatcatgtacggactcacagctacctttggataccttaccttctacagcactgtgaag
gcagagatgctggagatgtacacccaggaggacctgcttattctttgtgtgcgcctggcc
gtactgcttgcagtaaccctcactgtgcctgttgtccttttccctatccgccgagccctc
cagcagctgctcttcccaagtaaggccttcagctggccacgacatgtggcaattgccctg
attctgcttaatttggtcaatatccttgtcatttgtgtgccaaccatccgggatatcttt
gggtttattggctccacttcagcccctagcctcatcttcatccttcccagtgtcttctac
ctccgcattgtacctgctgacatggaacccttgttttcctggcccaagatccaggccctg
tgttttggcgtcctgggagtcctcttcatggccatcagtctgggctttatgtttgctaat
tgggctacaggccagagccgtatgtctggccattga

DBGET integrated database retrieval system