KEGG   Rattus norvegicus (rat): 192215
Entry
192215            CDS       T01003                                 

Gene name
Slc9a5, Nhe5
Definition
(RefSeq) solute carrier family 9 member A5
  KO
K14723  solute carrier family 9 (sodium/hydrogen exchanger), member 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    192215 (Slc9a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   192215 (Slc9a5)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD
Other DBs
NCBI-GeneID: 192215
NCBI-ProteinID: NP_620213
RGD: 620473
Ensembl: ENSRNOG00000028844
UniProt: Q9Z0X2
Position
19q12
AA seq 898 aa
MLRVALLLLPGLPLAGVGATEEPTQEPGPLGEPPGLALFRWQWHEVEAPYLVALWILVAS
LAKIVFHLSRKVTSLVPESCLLILLGLALGGIVLAVAKKAEYQLEPGTFFLFLLPPIVLD
SGYFMPSRLFFDNLGAILTYAVVGTLWNAFTTGVALWGLQQAGLVAPRVQAGLLDFLLFG
SLISAVDPVAVLAVFEEVHVNETLFIIVFGESLLNDAVTAVLYKVCNSFVEMGSANVQAT
DYLKGVASLFVVSLGGAAVGLVFAFLLALTTRFTKRVRIIEPLLVFLLAYAAYLTAEMAS
LSAILAVTMCGLGCKKYVEANISHKSRTAVKYTMKTLASSAETVIFMLLGISAVDSSKWA
WDSGLVLGTLFFILFFRALGVVLQTWVLNQFRLAPLDKIDQVVMSYGGLRGAVAFALVIL
LDRTKVPAKDYFVATTIVVVFFTVIVQGLTIKPLVKWLRVKRSDYHKPTLNQELHEHTFD
HILAAVEDVVGHHGYHYWRDRWEQFDKKYLSQLLMRRSAYRIRDQIWDVYYRLNIRDAIS
FVDQGGHVLSSAGLTLPSMPSRNSVAETSVTNLLRESGSGACLDLQVIDTVRSGRDREDA
VMHHLLCGGLYKPRRRYKASCSRHFISEDAQERQDKEVFQQNMKRRLESFKSTKHNICFT
KSKPRPRKTGHKKKDGVANPEATNGKPPRDLGFQDTAAVILTVESEEEEESESSETEKED
DEGIIFVARATSEVLQEGKVSGSLEVCPSPRIIPPSPTCAEKELPWKSGQGDLAVYVSSE
TTKIVPVDMQTGWNQSISSLESLASPPCTQPPTLTRLPPHPLVPEEPQVPLDLSSDPRSS
FAFPPSLAKAGRSRSESSADIPQQQELQPLMGHKDHTHLSPGPANSHWCIQFNRGGRL
NT seq 2697 nt   +upstreamnt  +downstreamnt
atgctgcgcgtcgcactgcttcttctgcccgggttgcccctagctggagtgggggccaca
gaagaacccacccaggagccggggccgttaggtgagcctccaggcttggcgctcttccgc
tggcagtggcacgaggtggaggcgccctacctggtggccctgtggatcctggtggccagc
ttggccaaaatcgtgttccacctgtctcggaaggtgacgtctctggtccctgagagctgc
ctgctgattttgctgggcctggcgttagggggcattgtcttagctgtggccaagaaggct
gagtaccagctggagccggggaccttcttccttttcctgctccctcccatcgtgctagac
tctggctatttcatgccgagccggctgttttttgacaacttgggtgccattctcacctat
gccgtggtgggcacgctgtggaacgccttcacaacaggtgttgccctttggggcctgcag
caggctggacttgtggctcctagggtacaggctggcctgctggacttcttgctctttgga
agcctcatctcagcggtggaccctgtggctgtgttggctgtctttgaggaggtgcacgtc
aatgagaccctctttatcatcgtcttcggcgagtccctgcttaatgatgcagtaactgcg
gtgctgtacaaggtctgcaactcctttgtggagatgggctctgccaacgtgcaggccact
gactacctaaagggagtcgcctccctgtttgtggtcagtctgggcggggcagccgtgggc
ttagtctttgccttcctcctggccctgaccacacgcttcaccaagcgggtccgcatcatc
gagccgttgctggtcttcctcctcgcctatgcagcctacctcactgccgaaatggcctca
ttgtctgccattcttgcggtgaccatgtgtggcctgggatgtaagaagtatgtggaggcc
aacatctcccataagtcacgcacagctgtgaaatacacaatgaaaacgcttgccagctcc
gcagaaacggtcatcttcatgctccttggcatctcagccgtggactcttccaaatgggcc
tgggactctgggctggtgctgggcaccctcttcttcatcctgttcttccgagccctcggc
gtagtcctgcagacgtgggtgctgaatcagttccggctggcccctctggacaagattgac
caggtggtgatgtcctatgggggccttcggggggctgtggcctttgctctcgtcatccta
ctggacaggaccaaggtccctgccaaggactactttgtggccaccactattgtggtggtc
ttcttcacagtcatcgtgcagggtttgaccatcaagccactggtcaagtggctgagggtg
aagaggagtgattaccacaaacccaccttgaaccaggagctacacgagcacacttttgac
cacattctggctgcagtggaggacgttgtggggcaccatggctaccactactggagggac
aggtgggagcagtttgacaagaagtacctgagccagctcttgatgcggcggtcagcctat
cgtatccgagaccagatctgggatgtgtactacaggctcaacatccgagacgccatcagc
tttgtggaccagggaggccacgtcttgtcctccgcgggactcactctaccctctatgcct
agcagaaactctgtggcagagacttctgtcaccaacctgttgagggagagcggcagtgga
gcgtgtctggatctgcaggtgattgacacagtacgcagtggccgagaccgagaggatgct
gtgatgcatcatctgctctgcggaggcctctacaagccacggcgcaggtacaaagctagc
tgcagccgccacttcatctcagaggacgcccaggagcgacaggacaaggaggtcttccag
cagaacatgaagagacggctcgagtcttttaagtccaccaaacataacatctgtttcacc
aagagcaaacctcgaccccgcaagaccggccataagaagaaggatggtgtggctaatccc
gaagctacaaatgggaagcctcctcgagacctgggctttcaggacacagctgctgtgatc
ctaactgtggagtctgaggaggaggaagaaagtgagagttcagagacagagaaagaagat
gatgaagggatcatcttcgtggctcgagccaccagtgaggttctccaagaaggcaaagtc
tcaggaagcctcgaggtgtgtccgagcccacgcatcatccccccatccccgacctgcgcg
gagaaagagctaccctggaagagtgggcagggagacctggctgtgtatgtgtcttcagaa
acaaccaagatcgtgcctgtggacatgcagacaggctggaaccagagcatctcatccctg
gagagcctggcatcccctccctgtacccagcccccgactttaacccgcttacctccccac
ccactcgtccctgaagagccccaggttcctcttgacctgtcttctgaccctcgctctagc
tttgctttccccccaagcctggccaaagctggccgttctcgcagtgagagcagcgccgac
atcccgcagcagcaggagctgcaacccctcatgggccacaaggaccacactcatcttagt
ccaggccctgccaactcccactggtgcatccagttcaacagaggaggcaggctgtag

DBGET integrated database retrieval system