KEGG   Rattus norvegicus (rat): 192228
Entry
192228            CDS       T01003                                 

Gene name
Haus1, Ccdc5
Definition
(RefSeq) HAUS augmin-like complex, subunit 1
  KO
K16584  HAUS augmin-like complex subunit 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    192228 (Haus1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Augmin complex
    192228 (Haus1)
SSDB
Motif
Pfam: RICH
Other DBs
NCBI-GeneID: 192228
NCBI-ProteinID: NP_620219
RGD: 619909
Ensembl: ENSRNOG00000017067
UniProt: Q9R0A8
Position
18q12.3
AA seq 278 aa
MAALEEKASQVAEWLKKIFGDHPIPQYEMNARTTEILYHLSERNRVRDRDVNLVIEDLRQ
KASEYESEAKRLEDFLMESVNFSPANLSNTGSRFLNALVDSAIALEIKDTSLASFIPAVN
DLTSDLFRTKSKSEEIKLELGKLEKNLTATLVLEKCLREDLKKADVHLSAERAKAEGRLQ
NMDFLKAKAAEFRFGIRAAEEQLSSRGMDASLSHRSLVALSDKLSELKQQTIPLKKKLES
YLDLMPNPSLAQVKIEEAKRELDAIEAELTKKVDMMEL
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcggcgctggaggagaaagcatcacaggtcgctgagtggttgaaaaagatatttgga
gaccatcccattccacaatatgagatgaacgcacggacgacagaaattttatatcacctt
tcagaacgcaacagggtccgggacagggacgtcaacctggtaatagaggacttaagacag
aaagcgagtgaatatgagtcggaagccaaacgtcttgaagactttctcatggagagtgtg
aatttttcccctgccaatctgtcaaacactggttcccggtttctgaatgcattggtggac
agtgcaattgccctggaaataaaagatacgtcactagcaagttttatccccgcagtgaac
gatttgacttctgacctttttcgtaccaaatccaaaagtgaagaaatcaagcttgaactg
gggaaacttgaaaagaatctgacggcaacgttggtgttagaaaaatgtctccgagaagac
ctcaagaaagcagatgtgcacctgtctgcagaaagggccaaagccgagggccgcctccag
aacatggacttcctgaaagccaaggcggcggagttccggtttgggatccgagctgcagag
gagcaactttcatccagaggcatggacgcgtccctgtctcatcggtcactagtggcactt
tcagacaaactttcggaattaaaacagcagactatccctctgaagaagaaattggagtcc
tatttagatctaatgccgaatccatctcttgctcaggtgaaaattgaagaggcaaagaga
gaattagatgccatcgaggctgaactcacaaagaaagtagatatgatggagctgtga

DBGET integrated database retrieval system