KEGG   Rattus norvegicus (rat): 192234Help
Entry
192234            CDS       T01003                                 

Gene name
Eif2b5
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit 5 epsilon
  KO
K03240  translation initiation factor eIF-2B subunit epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    192234 (Eif2b5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    192234 (Eif2b5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    192234 (Eif2b5)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    192234 (Eif2b5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: W2 Hexapep Fucokinase DUF4954
Motif
Other DBs
NCBI-GeneID: 192234
NCBI-ProteinID: NP_620221
RGD: 708380
Ensembl: ENSRNOG00000038160
UniProt: Q64350
Position
11q23
AA seq 716 aa AA seqDB search
MAATAAVPSAVGGRANKRGGGSGGGGTQGAEEEPPPPLQAVLVADSFDRRFFPISKDQPR
VLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLQKSKWCHPTSLNVVRIITS
DLYRSLGDVLRDVDAKALVRSDFLLIYGDVVSNINISKALEEHRLRRKLEKNVSVMTMVF
KESSPSHPTRCHEDNVVLAVDSTTNRILHFQKTQGLRHFSFPLGLFQGSLDGVEIRYDLL
DCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHLHVTSREYGARVSNLHM
YSAVCADVIRRWVYPLTPEVNFTDSSTQSYTHSRHNIYRGPEVSLGHGSVLEENVLLGAG
TVVGSNCSITNSVIGPNCHIGDNVVLDQAYLWQGVRVAAGAQIHQSLLCDRAEVKERVIL
KPHCVLTSQVVVGPDIILPEGSVISLHPPDAEEDEDDGQFSDDSGADQEKEKVKLKGYNP
AEVGPEGQGYLWKAEDVDEKEDEELRQSLWGLMINMEEESETESERSVDPEELDSRAGSP
QLDDIRVFQNEVLGTLQRGREENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPL
QQVDGVLDPNRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHETLVPSLAK
VLMAFYQLEILAEETILSWFSQRDITDKGQQLRKNQQLQRFIQWLREAEEESSDDD
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcagccactgcggcggttcccagcgctgtaggcggccgagcgaacaaacgcggcggc
ggctccggcggcggtggaacccaaggtgcggaggaggagccgccgccgcccctccaggca
gttttagtggccgatagcttcgaccgccgcttcttccccatctccaaggaccagcctcgg
gtcctattgcccctggctaatgtcgcgctgatcgactatactctggaattcttgactgcc
acgggtgtacaggaaacatttgtcttttgctgctggaaggctgctcagatcaaagaacac
ttacagaaatccaaatggtgccatcctacgtccctcaatgttgttcgaataatcacatca
gacctgtaccgatcactaggagatgtcctccgtgatgtcgatgccaaggccttggtgcgc
tctgatttcctcctgatatatggagatgtcgtctcaaatatcaatatttccaaagccctg
gaggaacacaggttaagaaggaagctagaaaaaaatgtgtctgtcatgacaatggtgttc
aaagagtcctcacccagtcaccctacacgctgccatgaggacaatgtggtgctagctgtg
gatagcaccacaaacaggattcttcacttccagaagacccaaggcctccgccatttctcc
tttcctttgggcctattccagggcagtctagacggagtggagattcgatatgacttgttg
gattgtcacatcagcatctgctctcctcaggtagctcagctcttcacagacaactttgac
taccaaactcgagatgattttgtgcgaggcctgctagtgaatgaggagatcctaggaaat
cagattcacttgcatgtgacaagtagggaatatggtgcccgggtctccaacctacacatg
tactcagctgtctgtgctgacgtcatccgccgatgggtctaccctcttactccagaagtc
aacttcactgacagcagtacacaaagctacactcattcccgacacaacatctaccgaggg
cctgaagtcagcctgggccacggcagcgtcctggaggaaaacgtgcttctgggagctggc
actgtcgttggcagcaactgctccatcaccaacagtgtcattggccctaactgccacatt
ggtgataatgtggtactggaccaggcctacctgtggcagggagttcgagtggctgctgga
gcacaaatacaccagtctctgctctgtgacagagctgaggtcaaggagcgagtcatactg
aagccacactgtgtcctcacttcccaggtggtagtgggcccagacatcatactgcccgag
ggctcggtgatctctttgcaccctccagatgcagaggaagatgaagatgatggccagttt
agtgatgattctggcgctgaccaagaaaaggagaaagtgaagctgaaaggttacaatccg
gcagaagttggccctgaaggccagggatacctctggaaagctgaggatgtggatgagaag
gaagatgaagagctgcggcagagtctctggggactcatgatcaatatggaggaggaaagt
gagacggaaagtgagcggagcgtggatcccgaggagctggacagccgagcaggctcccct
cagctggatgacatcagagttttccagaacgaggtcttaggaacgctgcagcggggcaga
gaggagaacatctcctgtgacaatctagtcctggagatcaactccctcaagtatgcctac
aacattagcctaaaggaagtgatgcaggtcctgagccatgtggtcctggagttccccctg
caacaagtagatggcgtgcttgacccaaaccgctactgtgccctgctgcttcctctgctc
aaagcctggagccctgtttttcggaactacataaagcgcgcagctgaccatttggaagca
ttggcggccattgaggacttcttcttggaacatgaaactcttgttccttccctggccaag
gtcctgatggctttctaccagctggagatcttggctgaggaaacaatcttgagctggttc
agccaaagagacataactgacaaaggccagcagttacgtaagaatcaacagctgcagagg
ttcatccagtggctgagagaggcagaagaggagtcatctgacgatgactga

DBGET integrated database retrieval system