KEGG   Rattus norvegicus (rat): 192246Help
Entry
192246            CDS       T01003                                 

Gene name
Phf5a, Ac2-246
Definition
(RefSeq) PHD finger protein 5A
  KO
K12834  PHD finger-like domain-containing protein 5A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    192246 (Phf5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    192246 (Phf5a)
Spliceosome [BR:rno03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    192246 (Phf5a)
 Complex B
    192246 (Phf5a)
 Complex C
   U2 SnRNP specific factors
    192246 (Phf5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHF5 PolC_DP2
Motif
Other DBs
NCBI-GeneID: 192246
NCBI-ProteinID: NP_620243
RGD: 621555
Ensembl: ENSRNOG00000024170
UniProt: P83871 B4F759
Position
7q34
AA seq 110 aa AA seqDB search
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacatcatccagatttgattttctgccgcaagcaggctggtgtagctatcgga
agactgtgtgaaaaatgtgatggcaaatgtgtgatctgcgattcctacgtgcgtccctgt
accctggttcgcatatgtgatgagtgtaactatggatcctaccagggccgctgcgtgatc
tgtggaggtcccggagtctctgatgcctactattgtaaagagtgcaccattcaggagaag
gatagagatggttgcccaaagattgtcaatttggggagctctaagacagacctgttctat
gagcgcaaaaaatacggtttcaagaagaggtga

DBGET integrated database retrieval system