KEGG   Rattus norvegicus (rat): 192247Help
Entry
192247            CDS       T01003                                 

Gene name
Sez6
Definition
(RefSeq) seizure related 6 homolog
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi CUB
Motif
Other DBs
NCBI-GeneID: 192247
NCBI-ProteinID: NP_001099224
RGD: 619780
Ensembl: ENSRNOG00000009350
UniProt: F1MA42
Position
10q25
AA seq 992 aa AA seqDB search
MRPAALLLLPSLLALLAHGLSSEAPITGEGQATGIREMDGELTAAPTPEQSDRGVHFVTT
APTLKLLNHHPLLEEFLQEGLEGREEAPRPALPFQPDSPTPFTPSPLPRLTNQDNRPVFT
SPTPAVAAAPTQPHSRKKPWNPESEPPELYITSPLPPGPSMAVPTLHPEDRPSTTPPSQA
WTPTQEGPGDMGRPWVPEIMSKTTGLGIEGTIATSTASGDDEETTTTTIITTVTTIQPPG
PCSWNFSGPEGSLDSPAVPSVPSDVGLDCLYYISVYPGYGVEIKVKNISLQEGETITVEG
LGGPDPLPLANQSFLLRGQVIRSPTHQAAVRFQSLPLPAGPGTFHFHYQAYLLSCHFPRR
PAYGDVTVTSLHPGGSARFHCATGYQLKGARFLTCLNATQPFWDSQEPVCIAACGGVIRN
ATTGRIVSPGFPGNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGNNVEAP
PVYDSYEVEYLPIEGLLSSGRHFFVEFSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNF
SSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDLRDPQWNETEPACRAVCSGEITDSAG
VVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDIRVLRIGSGDVLTFYDGDDLTARVLGQY
SGPRGHFKLFTSMADVTIQFQSDPGTSALGYQQGFVIHFFEVPRNDTCPELPEIPNGWKN
PSQPELVHGTVVTYQCYPGYQVVGSSILMCQWDLSWSEDLPSCQRVTSCHDPGDVEHSRR
LISSLKFPVGATVQYICDQGFVLTGSAILTCHDRQAGSPKWSDRAPKCLLEQFKPCHGLS
APENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDG
FYNGRSLDVAKAPATSSALDAAHMAAAIFLPLVAMVLLVGGVYLYFSRLQGKSPLQLPGT
HPRPYNRITVESAFDNPTYETGSLSFAGDERI
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccagcagccctgctgctcctgccctcgctgctggcgctcctggctcacggactc
tcctcagaggctccaatcacgggggaaggtcaagccacgggcatcagggagatggatggg
gagctgaccgcagcccctacacctgagcagtcagaccgaggcgtccacttcgtcaccaca
gcccctaccctcaagctactcaaccaccacccacttctggaggaatttcttcaagagggg
ctagaagggagagaggaagctccgaggccggcactgcccttccagccagactcacctaca
ccctttactccaagcccccttccccgcctcaccaaccaggacaaccgccctgtctttacc
agtccgacgccagctgtagctgcggcacccacgcagccccactccagaaagaaaccctgg
aacccagagtcagagcccccggagctttacatcacatctcccctccctccagggccgagt
atggcagtgcccacactgcacccagaggacagacccagcactacaccccccagccaagca
tggactccaacccaggagggtcctggagacatgggcagaccttgggttccagagatcatg
tctaagaccacagggcttggtatcgaggggaccattgccacctccacagcttcaggggat
gacgaagagaccaccaccaccaccatcattaccaccgtcaccacaattcagccaccaggc
ccctgtagctggaatttctcaggcccggagggctctctggattcccctgcggtccccagc
gtcccctctgatgttggcctggactgtctctactacatctctgtctaccctggatatgga
gtcgagatcaaggtgaagaacatcagccttcaggaaggagagaccataaccgtggagggc
ctgggggggcctgacccactgcccttggctaaccagtctttcctgctgaggggccaggtc
atccgcagccccacccaccaggcagccgtgaggttccaaagccttccacttcccgctgga
cctggtactttccatttccactaccaagcctatctcctgagctgccactttcctcggcgt
ccagcttatggagatgtgactgtcaccagcctccacccaggaggcagcgcccgcttccac
tgtgccactggctaccagctaaagggtgccaggttcctcacctgtctcaatgccacccag
cccttttgggattcccaagagcctgtctgcattgctgcttgtggaggagtgattcggaat
gccaccactggccgcattgtctctcctggctttcccgggaactacagcaacaacctcacc
tgccactggctgctagaagcccccgagagccagcggctgcacctgcactttgaaaaggtc
tccctggcagaagatgacgacaggctcatcatccgtaacgggaataacgtggaggccccg
ccagtgtatgactcctatgaggtggagtacctgcccattgagggcctgctcagttctggc
agacacttcttcgtggagttcagtactgacagcagcggggcagccgcaggcatggcactg
cgctatgaggccttccagcaaggacattgctatgagccctttgtcaaatacggtaacttc
agcagcagcgcaccgtcctaccctgtgggtacgactgtggagttcagctgtgaccctggc
tacaccctggagcagggttccatcatcatcgaatgcgtcgacctccgtgacccccagtgg
aatgagacagaaccagcctgccgagccgtgtgcagcggggagatcacagactctgcaggc
gtggtgctctctccaaactggccggagccttatggccgagggcaggactgcatctggggt
gtgcatgtggaggaggacaagcgcatcatgctggacatccgagtgctgcgcataggctct
ggggatgtactgaccttctacgatggggatgacctgacagcccgggtcctgggccaatac
tcagggccccgtggccacttcaagctctttacctccatggctgatgtcaccattcagttc
cagtcagaccctgggacgtcggcgctgggttaccagcaaggatttgtcatccacttcttt
gaggtgccccgcaatgacacatgtccagagcttcccgagatccccaacggctggaagaac
ccatcacagcctgagctggtgcatggcacggtggtcacctatcagtgctaccccggttac
caggtggtgggatccagtattctcatgtgccagtgggacctgagctggagtgaggacctg
ccctcatgccagagagtgacatcctgccatgacccaggggatgtggagcacagccgacgc
ctcatatccagcctcaagtttcctgtgggagcaactgtgcagtatatctgtgaccagggt
tttgtgctcacgggtagcgccatccttacttgccatgatcgtcaagcgggcagtcccaag
tggagtgacagggcccccaagtgtctcttggaacagttcaaaccatgtcatggcctcagt
gcccctgagaatggtgcccgcagccctgagaagaggctccacccagcaggggccaccatt
cacttctcctgtgcccctggttatgtgctgaagggccaggccagcatcaaatgcgtgcct
ggacacccctcacattggagtgatcctccacccatctgtagggctgcttctctggatggg
ttctacaacggccgtagcctggatgttgccaaggcacctgccacctccagtgccctggat
gctgcccacatggcagctgccatctttctaccattggtggccatggtgttgctggtggga
ggagtgtacctctatttctccagactccagggaaaaagtcctctgcagcttcccggaact
catcctcgcccctataaccgtatcacggtagagtcagcatttgacaatccaacttatgag
accggatctctttcctttgcaggagacgagagaatatga

DBGET integrated database retrieval system