KEGG   Rattus norvegicus (rat): 192248Help
Entry
192248            CDS       T01003                                 

Gene name
Cdh13, Cdht, T-cadherin, Tcad
Definition
(RefSeq) cadherin 13
  KO
K06808  cadherin 13, H-cadherin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    192248 (Cdh13)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    192248 (Cdh13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    192248 (Cdh13)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   192248 (Cdh13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_pro Cadherin_4 Cadherin_3 Big_9 Cadherin_2 Cu-binding_MopE
Motif
Other DBs
NCBI-GeneID: 192248
NCBI-ProteinID: NP_620244
RGD: 619745
Ensembl: ENSRNOG00000014371
Vega: OTTRNOG00000000129
UniProt: Q8R490
Position
19q12
AA seq 714 aa AA seqDB search
MQPRTPLTLCVLLSQVLLVTSAGDLDCTPGFQQKVLHIHQPAEFIEDQPVLNLTFSDCKG
NKKLHYEVSSPYFKVNSDGTLVAVRNITAVGRTLFVHARTPHAEDMAELVIVGGKDIQGS
LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGV
DQDPKGTFRINENTGSVSVTRTLDRETIATYQLFVETTDASGRTLEGPVPLEVIVIDQND
NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIVIDDKNDHS
PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPATGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
PMMVTKQENISVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLSINPINGTVDTTAVLD
RESPFVHNSVYTALFLAIDSGNPPATGTGTLMITLEDVNDNAPVIYPTVAEVCDDARNLS
VVILGASDKDLHPNTDPFKFEIHKQTVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
VTDSGKPPMTNITDLRVQVCSCKNSKVDCNAAGTLHLSLSLLLLFSLLSLLSGL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgagaactccgctcaccctgtgcgtcctgctgtcccaggtgctcctggtaaca
tctgcaggtgatttggactgcacccccggattccagcagaaagtgctacacatccaccag
cctgccgaattcatcgaggaccagccggtcctaaacttgaccttcagtgactgcaagggc
aacaagaagctgcactatgaggtctcaagcccatacttcaaggtgaacagcgatggcacc
ttagtggctgtcagaaacatcactgcggtgggcaggaccctgtttgtccacgcaaggact
cctcatgccgaagacatggcagaactcgtgattgtcggggggaaagacatccagggctcc
ttacaggacatttttaaatttgcaaggacatctcctgtcccaagacaaaagaggtccatt
gtggtgtcccccatcttgatcccagagaaccagagacagcccttccccagagatgttggc
aaggtcgttgatagtgacagacccgaagggtccaagttccggctcacggggaagggagtg
gatcaagaccctaaagggactttcagaatcaatgagaacacgggaagcgtctccgtgaca
cggaccctggacagagaaacgatcgctacttatcaactgtttgtggagaccacagatgcc
agtggcagaactctggagggaccagtgcctctggaagtcatcgtgattgatcagaatgac
aaccgacccatcttccgggaaggcccttacatcggccatgtcatggaagggtcacccaca
gggaccacggtgatgcggatgacagcgtttgatgcagatgacccggccactgacaacgct
ctcctgcggtacaacatccgtcagcagacgcctgacaagccgtctcctaacatgttctac
atcgatcccgagaaaggagacattgtcaccgtggtgtcacctgcgctgctggaccgggag
actctggaaaaccccaagtatgaactgatcatcgaagctcaagatatggcaggactggac
gttggattgacaggcacggccacagccaccattgtgatcgatgacaaaaatgatcactca
ccaaaattcaccaagaaagagtttcaagccacagtggaggagggagccgtgggagtcatt
gtcaacttgacagtggaagacaaagatgaccccgcgacaggagcatggagggcggcatac
accatcatcaatggaaatcctgggcagagctttgagatccacaccaacccacagaccaac
gagggcatgctctctgtggtcaagcccctggactatgagatctctgcctttcacaccctg
ctgatcaaagtggagaatgaggacccattggtacccgacgtctcctatggccccagctcc
acggccactgtccacatcacggtcttggatgtcaacgagggaccagtcttctacccagac
cccatgatggtgaccaaacaggaaaatatctctgtgggcagtgtgctgctgacagtgaat
gccacagacccggactccctgcaacatcaaactatcaggtactctgtttacaaggaccca
gcgggctggctgagtattaaccccatcaatggcactgtcgacaccacagctgtgttggac
cgggagtctccattcgtccacaacagtgtgtacactgccctcttcctggccatcgacagc
ggcaaccctcctgcgactggcaccgggactctgatgatcaccctggaggacgttaacgac
aacgctcctgtcatttacccaacggtggctgaagtctgcgacgacgccagaaacctcagc
gtggtcatcctgggggcttcagacaaggaccttcaccccaacacagaccccttcaagttc
gagattcataaacagaccgtccctgataaagtctggaagatctccaaaatcaacaacacc
cacgccctcgtgagccttcttcagaatctgaacaaggcgaactacaacctgcccatcatg
gtgacggattcagggaagccacccatgacgaacatcacggacctcagggtgcaggtgtgc
tcttgcaagaactccaaagtggactgcaatgcggcggggaccctgcacctcagcctcagc
ttgctgctgctcttctctctcctcagcttattgtcaggtctgtga

DBGET integrated database retrieval system