KEGG   Rattus norvegicus (rat): 192251
Entry
192251            CDS       T01003                                 

Gene name
Gpr149
Definition
(RefSeq) probable G-protein coupled receptor 149
  KO
K08433  G protein-coupled receptor 149
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    192251 (Gpr149)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    192251 (Gpr149)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 192251
NCBI-ProteinID: NP_620246
RGD: 619890
Ensembl: ENSRNOG00000014793
UniProt: Q924Y8
Position
2
AA seq 730 aa
MSFFLSNLTNDSRLWKVSHNSTDLMNSPETLTLSLFCLICLMTLVALVGSIFSLVSLLTM
QYRTVVSMLVTSWSVDDLLSVLSVAIFMVLQWPREAPGYFQSLCTTSALLYMCQGLSSNL
KATLIVFYNFYTMHRTVVSQSSSWRSGQVLGVALTVWAVSLLLASLPLCGWGVFVRTPWG
CLTDCSSPYVLLLFAVYASAFGLLAVLSVPLTHQLLCSEEPPRLHANYQEISRGASTPGT
PAAGGRVLCLLPEDVEIPALPGTGSSLSSDMVFAPGQPAASSAGAGKRENLWTPRGSSSF
PVSLAQKRFALILALTKVILWLPMMIHMVVKHVVGFQSLPVDMLSFLLTLLASTVTPVFV
LSKRWAHLPCGCIINCQPDTYSVAFDGKKSKRKGFEFNLSFQQSYGLYKMTHADYYDDDD
ENPISYHNPKKYECEATKEPREDNHGVFNTITVEISTTPPLDSATLTGVNKCTNTDIPEP
KQAVSEEKGAFSIKTECAINYGEATSFEGPERRLSHEETQKPDLSDWEWCRSKSERTPRQ
RSGGGLAIPICAFQGTVSLQAPTGKTLSLSTYEVSAEGQKITPPSKKIEVYRSKSVGHEP
NSEESPSTFADTNVKIHLEVLEICDNDEALDTVSIISNISQSSTKVRSPSLRYSRKENRF
VSCDLGETASYSLFLPTSDPDGDINISIPDTVEAHRQNSRRQHQDRDGYQEEIQLLNKAY
RKREAESKGN
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtcgttcttcctcagcaacttaacaaatgactctagactgtggaaagtaagtcataat
tctacggaccttatgaattcgccagaaactctgactctttctctcttttgcctgatctgt
ttaatgactctcgtagctctggtaggcagcattttctcactggtttctctgctcaccatg
cagtacagaactgttgtgtctatgcttgtgacctcttggtctgtggatgatctcttgagc
gtcttgtcagtggccatcttcatggttttgcagtggccaagagaggcaccgggctacttc
cagtctctgtgtaccacctctgccttactgtatatgtgccagggcctctccagcaacttg
aaggcgactcttatagtcttctacaacttttatacgatgcacaggacagtggtgagtcag
tcaagctcctggcgatcaggacaggtactcggtgtggctttaaccgtgtgggcagtcagc
ctgctgctggcctcgctcccgctgtgcggctggggtgtcttcgtgcgcacgccttggggc
tgcctgaccgactgctccagcccatacgtgctgctcctcttcgcggtgtacgcttccgct
ttcgggctcctggcggttctttctgtccctctcactcaccagctgctgtgttcagaggag
ccgccaagactccatgccaactaccaggaaatttctcgtggcgcctctactcctgggacc
cctgctgctgggggaagagtgctctgtctgttgccagaggatgttgaaatccctgctctg
ccaggcactgggagctccctgagctccgacatggtgtttgcaccgggtcagcctgctgcc
tctagcgctggagccggcaagcgagagaatctctggactccccgtggctcgagcagcttc
cccgtgagcctggcacagaagcgctttgctttgatcctagcgctgactaaagtcatcctc
tggctgcctatgatgatccacatggtggtaaaacacgtggtggggtttcagagccttccg
gtcgatatgctcagctttctactaaccctgctggccagcactgtaacaccagtgtttgtc
ttgtctaaacgatgggcccacttgccttgtggctgcatcatcaactgccagcctgacacc
tactccgttgcattcgatgggaaaaagtcaaagaggaaaggctttgaattcaatttatcg
ttccaacaaagttatggactctataagatgacacatgcagattactatgacgatgatgat
gaaaatcccatatcctaccacaacccaaagaaatatgagtgtgaagctacaaaggagcct
cgggaagacaaccacggtgtgttcaataccatcacagtagaaatcagcaccacgccaccg
ctggacagcgccacactgaccggtgtcaacaagtgcaccaacacggatatccctgagccc
aaacaggccgtgagcgaagaaaagggtgccttttctattaaaacagaatgtgctattaac
tatggagaagccacctcgtttgaaggtccagagagacgactgtcccatgaggagactcag
aaaccagatctttcagactgggagtggtgcaggagtaagtcagaacgaacacctcgccag
cgttctggtggtgggctggctattcccatttgtgcgttccaagggactgtgtctctccaa
gcaccaactgggaaaaccctctctctttctacttatgaggtcagtgcagaagggcaaaag
ataaccccgccctctaagaaaatagaagtctatcgatctaaaagtgttggccatgaaccg
aactcagaagagtctccctccacgtttgcagacaccaacgtaaaaatacacttggaagtt
cttgaaatttgtgacaacgatgaggctttagacactgtgtcaatcatcagcaacatcagc
cagtcctctacaaaagttcggtctccttctctgcgctactcacggaaggaaaacaggttt
gtctcatgcgacttaggagaaactgcctcctactccctcttcttacccacaagtgatcct
gacggagatatcaacatctctatcccagacacagtggaggcacacagacagaacagcagg
cggcagcatcaagacagggatggctaccaggaagagatccagttgttaaacaaagcctac
aggaaaagagaagcagaaagcaagggtaactag

DBGET integrated database retrieval system