KEGG   Rattus norvegicus (rat): 192253Help
Entry
192253            CDS       T01003                                 

Gene name
Myo16, Myr8
Definition
(RefSeq) myosin XVI
  KO
K17481  myosin XVI
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    192253 (Myo16)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    192253 (Myo16)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     192253 (Myo16)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     192253 (Myo16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head NYAP_N Ank_2 Ank_5 Ank_4 Ank_3 Ank AAA_16 IQ Zeta_toxin TsaE
Motif
Other DBs
NCBI-GeneID: 192253
NCBI-ProteinID: NP_620248
RGD: 621561
Ensembl: ENSRNOG00000016483
Vega: OTTRNOG00000000953
UniProt: Q9ERC1
Position
16q12.5
AA seq 1912 aa AA seqDB search
MEIDQCLLESLPLGQRQRLVRRMRCEQIKAYYEREKVFQKQEGLLKRIKPGKSQKVRFGL
ADMIQDAIIHHHDKEVLQLLKEGADPHTLVSSGGSLLHLCARYDNVFIAEVLIDRGVNVN
HQDEDFWAPMHIACACDNPDIVLLLILAGANVLLQDVNGNIPLDYAVEGTESSAILLAYL
DENGVDLNSLRQIKLQRPLSMLTDVRHFLSSGGDVNEKNDDGVTLLHMACASGYKEVVLL
LLEHGGDLNGMDDGYWTPLHLAAKYGQTTLVKLLLAHQANPHLVNCNGEKPSDIAASESI
EEMLLKAEIAWEERMKESPSVPSLAQEELYEEILHDLPELSSKLSPLVLPIAKQDSLLEK
DIMFKDTTKGLCNQESQDGPPETSMVSSSSKPEQVQLTPPAPSDDLATLSELNDSSLLYE
IQKRFGNDQIHTFIGDIFLLVNPFKELPIYSTVVSQMYLSPTGQRSPSLPPHLFSCAERA
FHRLFQERRPQNIILSGERGSGKTQASKQIMKHLTSRASSSCTMFDSRFKHAICILEAFG
HAKTTLNNVSSCLIQYWELQFCQRRKHVTGARISTYMLEKPRLVAQPPGQGSFLIFSWLM
DGLSAEEKCGLHLSNFCAHRYVSQGMREDVSTAERSLNKERLADLKHALNVIGFSALEVE
NLFAILSAILHIGDIQFTALTEADSAFVSDLQLLEQVADMLQVSTDELASALTTDIQYFK
GDVIIRRHTTQIAAFYRDLLAKSLYSRLFGFLINTVNCCLQSQDEYKSLQTLDIGILDIF
GFEEFQKNEFEQLCVNLTNEKMHHYIQEVLFLQEQTECVQEGVAMETACSPGNQAGVLDF
FFQKPSGFFSLLDEESQAIWSVEPNLPRKLQGLLESSNTNAVYSPMKDGNGNVAFKGQGA
AFTVMHYAGRVTYEIRGAVERNKDSLSQNLLFVMKTSENVVISHLFQSKLSPTGSLISSY
PSFKFGGHKSSLLSKRIASSMVGVNKNYLELSKLLKKKGTCTFLQRLERGDPATTASQLT
KSLADITAKLQKGSPHFILCVKPNTSQLPGVFDHFYVSAQLQYLGVLGLVRLFRYGYPVR
PSFEDFLSRYEPLASVLLGEKKGQPAEERCRLVLQRCKLQGWQMGVHKVFLKYWQVDQLG
DLWLQMQRKIVTCQKVIRGFLARQHLLQRMSIKQQEVTSIKSFLQSTEDMALKTYDALVI
QNASDIAREHDRLRKEVHAAYHRNRQEEGTKRAEDQGGCRHAHSNSVPVPMAVDSLAQAL
AGPSSRSPSLHSVFSMDDSTGLPSPRKQPPPKPKRDPNTRLSASYEAVSACLSATKDAAS
EALTRPRPHSDDYSTMKKIPPRKPKRSPHTKLSGSYEEIWGPRPSGTMGQVGKHHAPGTL
GVQWASPDSMPQCTPQLPLHLPLPQGDYDDDGEPVYIEMVGNAARAGGSETDSPDQGESV
YEEMKYVLPEEGCGPGMLTFLPASPPLFLETRKAIILEAGEGSCQPLKDTCDIPPPFPNL
LPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQSEGSSPLSPQYSKA
QKGENDQLTSPGFPVFNGPSRISPPATPPPPPGPPPAPCGPPSAPCGPPPAPCGPPPVPC
GPPPAPCGPPPAPCGAAPAPCRPPTHFAFPPDSVLVTAAKALTNSDLPRTQPKPSSAPVL
GPCSPFVKAPYSPGRTARADLRKASSTFSPPSPYSPPNSRPLSSPLDELASLFNSGRSVL
RRSAVGRRIREAEGFETNMNLSSRDEPSSSEMASETQDRNANNHGTQLSSSLSSVVAAEN
GNPVTNGLAEDDGCSRLCLSGMGTSSFQRHRESHTTQVIHQLRLSENESVALQELLDWRR
KLCESREGWQEAMQHPEPRAPPPPPCKKPTLLKKPEGGSCTRLSSQLWDSSI
NT seq 5739 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaccagtgcttgctggagtccctccccctgggccagcggcagcgtctggtg
aggcgcatgcgctgtgagcaaatcaaagcctactatgagcgagagaaagtgttccagaag
caggaagggctcctgaagagaattaagcctgggaaaagccagaaggtccgcttcggcctg
gctgacatgattcaggatgccattatccaccaccacgacaaagaggtgcttcaactcttg
aaggagggggccgacccacacactcttgtttcctcaggagggtctttacttcacctgtgt
gctcgctatgacaatgtcttcatcgcagaagtcctcattgacaggggtgtcaatgtcaac
caccaggatgaggacttttgggccccaatgcacattgcctgtgcctgtgacaaccctgac
attgtcctgttgctcatattagctggagccaacgtccttctgcaagatgtgaatggaaat
atcccgttagattacgctgtcgaagggacagaatctagtgctatcctgctggcctatttg
gatgaaaacggggtggacctgaactctctgcgccagataaagctgcagcggcccctgagt
atgctgacagacgtcaggcacttcctgtcttcaggtggagatgtcaacgagaaaaatgat
gacggggtgaccctgctgcacatggcgtgtgccagtggctacaaagaggtggtgcttctc
ctcttagaacatggcggagacctcaatgggatggatgatgggtactggacacccctgcat
ttagcagccaagtatggccagacaaccctggtgaagctccttctggcacatcaggcaaac
ccccaccttgtgaactgcaatggggagaaaccatcagacatcgctgcctctgagtctatt
gaggagatgctgctgaaagcagagattgcctgggaggagagaatgaaagagtccccgtct
gttcctagcttagcacaggaggagctgtatgaggagatccttcacgacctcccggagctt
tccagtaagctcagtcctctggtgctaccaattgccaagcaggacagtttgctggaaaaa
gacattatgttcaaagacacaacaaaaggtctgtgcaaccaggaatcccaggatggccct
cctgagaccagcatggtgagcagctccagcaagccagaacaggtccagctcacgcctcca
gctcccagtgatgacctggccacactcagcgagctgaatgacagcagcctgctctatgaa
atccagaagcgcttcgggaatgaccagatacacaccttcatcggagacatctttttgctc
gttaaccctttcaaagaactcccaatttactccactgtggtgtcccaaatgtacctgagc
cccacaggccagcgcagcccctcactgccaccccacctcttctcctgtgcagagagagcc
ttccacaggctgttccaggagcgaaggccacagaacatcatcctcagtggagaaagaggt
tcggggaagacccaggccagcaagcaaatcatgaagcaccttaccagcagggccagctcc
agctgtaccatgtttgactccagattcaagcatgccatatgcatcttggaggccttcgga
catgccaagaccacactcaacaacgtatccagttgcctcatacagtactgggaactgcag
ttctgtcagaggagaaaacacgtaactggagccagaatttccacttacatgctggagaag
cccaggcttgtggctcagcctcctggccagggcagcttcctgattttctcctggttgatg
gacggcttatccgcagaagaaaaatgtggacttcaccttagtaacttctgtgcacaccgg
tacgtgagccaaggcatgcgggaagatgtgtccacagcagagcgttctctgaacaaggag
agacttgcagatctgaaacatgctctgaatgtaattggcttcagcgccttggaggtggag
aacctgttcgctatcctgtcggcgatcttacacatcggagacatccagttcaccgcgctg
acggaagctgactcggcctttgtctctgacctccagcttctggaacaagtggcagacatg
ttgcaagtgtcgacagatgagctggcatccgccctaacaactgatattcagtattttaaa
ggagatgtgataatacgtcgacacaccacccagatcgctgcattttaccgagacctcctg
gccaagtcgctgtacagccgattgtttggttttctgataaacactgtgaattgctgcctc
cagagtcaagatgaatataaaagcctacagacattggatattggaatactggacattttt
ggttttgaggaatttcaaaagaatgaatttgaacaactctgtgtcaacctgaccaacgaa
aaaatgcaccactatatccaagaagtgcttttcctacaagagcaaacagagtgtgtacaa
gagggagttgccatggaaactgcctgttctcctggtaaccaggctggagttttggatttc
ttcttccagaaaccatcaggattcttctccctattggacgaggagagtcaagcgatttgg
tcagtggagccaaaccttcccaggaagctgcagggtctcctggaatcatcaaacacaaat
gcagtctattcccccatgaaggacggcaacgggaatgttgctttcaaaggtcaaggcgca
gccttcactgtcatgcactacgcaggaagggtaacgtatgaaatcagaggagcggtggaa
aggaataaagactctctttcacagaacctcctatttgtaatgaaaacaagtgaaaatgtc
gtgatcagtcacctgttccagtcaaaactctcaccgacgggatcgctcatatcttcctac
ccatcctttaaatttggaggacacaaatccagcctgctcagtaagagaattgcctcttca
atggttggagtgaacaagaattacctagaacttagcaagttattaaaaaagaagggaact
tgcacattcctacaaagactggaacgcggagaccccgccactactgcgtcgcaactcacg
aaatctctggcagacatcactgcaaagctgcagaagggcagtccgcacttcatcctttgc
gtcaagcctaatacctcacagctacctggtgtgttcgatcacttctacgtgtctgcccaa
ctgcagtacctcggtgtcctagggctggtgaggctgttccgctatgggtacccagtgcgc
ccttccttcgaggacttcctgtccagatatgagccactggcttctgtcctcctgggtgag
aagaagggtcagcccgccgaggagagatgtcggctggttctccagcggtgtaaactacaa
ggttggcagatgggcgtccacaaagtgttcctgaagtactggcaggtggaccagctcggt
gacctgtggctccagatgcaaaggaagattgtaacttgtcagaaagttataagagggttt
ctagcccgccagcacttacttcagagaatgagcatcaagcagcaagaggttacatccatc
aagagcttcttacagagcacagaggacatggcactgaaaacctatgatgccctggttatt
cagaacgcttctgacattgcccgggaacatgataggctccggaaggaggtccatgctgcc
taccacaggaacagacaagaggaaggaaccaagagagctgaagaccagggaggatgccgg
catgcccattccaactcggttcccgtgcccatggcagtggacagccttgcccaggctctc
gccggcccgtccagtcggtccccatcactgcactctgtgttcagcatggatgacagcact
ggcctcccgtcaccacggaaacagcctccacccaagccaaagagggaccccaacacccgg
ctgagtgcctcctatgaggctgtgagcgcctgcctttcggccaccaaggatgcagccagc
gaagctctgacacggcccagaccccacagtgatgattacagtaccatgaagaaaattccc
cctcggaagccaaagagaagtccccacacgaagctcagtggctcttatgaggagatctgg
ggaccgaggccttctggtacaatgggccaggtgggcaaacatcatgccccagggacactg
ggtgtgcagtgggccagtcctgactccatgccacagtgcacaccccagctgcctctgcac
ctgccattgccacagggtgactatgacgatgacggcgagcctgtgtatatcgagatggta
gggaacgcagccagggcaggcggatctgagactgacagccctgaccagggcgagtctgtg
tatgaggagatgaagtacgtcttgcctgaggagggctgtggtccagggatgctcaccttc
ctgcctgcctcgccacctctgtttttagagacccgaaaagccatcatcttggaggctgga
gaggggagctgccagcccctgaaggacacgtgtgacatccccccacccttcccgaatctg
cttccccataggccgccgctcctggtctttcctcccaccccagtgacctgctccccagct
tctgatgagtctccactgacacccttggaggtaaagaaactgccagtcttagagaccaac
ctcaagtacccagtgcagtccgaaggctccagtcccttgtcaccacagtactcaaaagca
cagaagggagaaaatgaccagctgacgtctcctggctttcctgtgtttaatgggcccagc
cgaatctcaccacctgccacaccaccgccacctccagggccacctcctgcaccctgtggg
ccaccttctgcaccctgtgggccacctcctgcaccgtgtgggccacctcctgtaccctgt
gggccacctcctgcaccctgtgggccacctcctgcaccctgtggggcagcccctgcaccc
tgcaggccacccacacactttgcctttccaccagattctgtcttggtcactgcagctaaa
gcactgactaactctgacctgcccagaacacagccaaagcccagttcagccccagtactg
ggtccctgcagcccctttgtcaaggctccatattcacccggaaggacagccagagcagac
ctcaggaaggcctcatccaccttctccccaccgagcccttacagcccacccaacagcagg
ccgctgtccagccctctggatgagctggccagcctcttcaactcgggaaggagtgtgcta
cgcaggtctgcagtgggacgaaggatcagggaggctgaaggttttgaaactaacatgaac
ctgagtagccgggatgaacccagctcatcagaaatggcttccgagactcaagacagaaac
gcaaacaaccacgggactcagctctccagctccctgtccagtgtcgtcgcggctgaaaat
ggaaatcctgtcaccaacggtttagctgaggacgatgggtgctcaaggctgtgtctgagt
ggcatggggacttcatcatttcagagacatcgggagagccacaccacccaggttatccat
cagctgaggctctccgagaatgaaagcgtagctcttcaggagctgctggactggaggagg
aagctctgtgagtccagagaaggctggcaggaagccatgcagcacccagagccccgcgca
cctccaccgccaccctgcaagaagccgacactcctaaagaagccggaggggggctcctgc
actaggctgtcttcccaactctgggacagtagtatctga

DBGET integrated database retrieval system