KEGG   Rattus norvegicus (rat): 192259Help
Entry
192259            CDS       T01003                                 

Gene name
Plb1, Phlpb
Definition
(RefSeq) phospholipase B1
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    192259 (Plb1)
   00565 Ether lipid metabolism
    192259 (Plb1)
   00590 Arachidonic acid metabolism
    192259 (Plb1)
   00591 Linoleic acid metabolism
    192259 (Plb1)
   00592 alpha-Linolenic acid metabolism
    192259 (Plb1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    192259 (Plb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192259 (Plb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     192259 (Plb1)
    3.1.1.5  lysophospholipase
     192259 (Plb1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    192259 (Plb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 192259
NCBI-ProteinID: NP_620253
RGD: 621565
UniProt: O54728
Position
6q14
AA seq 1450 aa AA seqDB search
MESWPGVSLVGLLLLLLLGQGPSQIHGSSGENTSQPQQVFRTLKNFSFPCKPKKLELSVL
SKSVHSLRPSDIKLVAAIGNLETPPAPGSGVVNMEKPQSLESELQNVCIGIMTALSDIIR
HFNPSVLMPTCSPGKGTAGHTTIAEDLWIQAKELVRHLKDNPELDFEKDWKLITVLFSNT
SQCHLCSSDQQKRHLMKHMEMLSGVLDYLHREVPRAFVNLVDLSEVLTMAQQHQETGFSP
APEICKCSEEITKLSKAVMQWSYQEAWEDLLASSKFNKHETFAVVFQSFFSEVELPLERP
SPQDSTTLALRIWNSMMEPVGRKDGTLNEAERKTMKCPSQESPYLFTYRNSNYQARQLKP
IGKFQMKEGTKFTCPDKDPSDSIPTTVHRLRPADIKVIGAMGDSLTAGNGAGSSPGNVLD
VLTQYRGLSWSVGGDETIETVTTLANILREFNPSLKGFSVGTGKENTPRASFNQAVAGAK
SDGLAAQAKKLVSLMKDDKTINFQEDWKIITVFIGGNDLCGSCNNLARFSPQTFTDNIKT
ALDILHAEVPRAFVNMVSVIEITPLRELFNEPKVSCPRMILRSLCPCVLNLGENSAELAQ
LVERNRQYQEETGKLIESGRYDTRDDFTVVLQPMFENVVMPRTLEGLPDSSFFAPDCFHF
NVKTHARSAIALWKNMLEPVGRKTRHQNFEIKVPIMCPNQTSPFLSTTKNSNLGHGTSMS
CEEKAPSASPPTSVHTLRPADIQVVAALGDSVTAGNGISSQEGDLADVTTQYRGLSYSAG
GDKFLENVTTLPNILREFNGNLTGYSVGTGDVNSASAFLNQAVPGAKAENLASQVQTLIQ
KMKNDTRVNFHQDWKVITVMIGASDLCDFCKDSNRYSAANFSDHLRNALDILHKEVPRAL
VNLVDFMNPSIIRQVFLKNPDKCPVNQTSVLCNCVLTPGEDSHELARLEAFTKSYQSSML
QLVESGRYDTREDFSVVLQPFLFNIRLPILENGNPDTSFFAPDCILLSQKFHTQLARALW
ANMLEPLGKKMDTLDPKELIALACPTKDKPFLRTFRNSNYTYPIKPAIENWGSDFLCTEQ
SPSSKVPTSVHELRPSDIKVVAAMGDFLTTATGARPSESSSLDTPWRGLSWSIGGDGTLE
THTTLPNILKKFNPSILGFSTGTLENTAGLNVAEEGARAQDMPAQAQALVKKMKSTPTIN
IQEDWKLITLLIGNNDLCLYCEDPENYSTREYVKYIQHALDIFYEELPRVFINVVEVMEL
SGLLHDQGGKCAMPLAVQKNCSCLKRSQNLMAMQELKKVNGNLQSALSELSYWHRYMQRE
DFAVTVQPFFRNTFVPLDERGGLDLTFFSEDCFHFSVRGHAEMAIALWNNMLEPVGKKTT
SNNFTYNRTKLKCPSPENPFLYTVRNSQILLDKAKENSNTLYWAVPVAAVGGLVVGILGM
MLWRTVRLVQ
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atggagtcatggccaggcgtttccctggtgggactgctgctgctgctactgctgggacaa
gggccctcccaaatccacggctcttctggagaaaacacatcgcagccccagcaagtgttt
cggaccctgaagaatttttcattcccttgcaagccaaagaagttagaactgagtgtgctt
tctaagtcagttcactctctgagaccctcagacattaaactcgtggcagccatcggcaac
ctagaaactcctccagcccctggctcaggcgtggtcaacatggagaaacctcaaagcctc
gagagcgaactacagaatgtgtgcataggaatcatgacagccctttcagatatcatcaga
catttcaacccttctgttctgatgcccacgtgttctcctgggaagggtactgcaggccac
actactattgccgaagacttgtggattcaggctaaagagctggtgaggcatctgaaagac
aacccggaacttgattttgagaaggactggaaactcatcactgtgctcttcagtaacaca
agccagtgccacctgtgttcctctgatcagcagaaaaggcacttgatgaagcacatggag
atgctgtcaggggtgctggattacctgcatcgtgaggtccccagagcgtttgtgaatttg
gtggatctctctgaggttttgaccatggctcagcagcatcaagagactggtttcagccct
gcaccagagatttgcaaatgctcagaggaaataacgaagttatccaaggctgtcatgcag
tggtcctatcaggaagcctgggaagatctcctggcctccagcaagttcaataagcatgag
accttcgctgtggttttccagtctttcttctctgaggtagaactacccttggagaggccc
tcgccccaggattccaccacgctcgccctcaggatctggaatagcatgatggaaccagtg
ggtcgaaaggatgggacactcaatgaagcagagagaaaaacaatgaaatgtccctctcag
gagagcccctatctgttcacctacagaaatagcaactaccaggccagacagctgaaaccc
ataggaaagtttcagatgaaagaaggaacaaaattcacctgtcctgacaaagacccctcg
gactccatccccacaacagttcacaggctgaggccggctgacatcaaggtcatcggagcc
atgggtgactcgctcacggcaggcaacggggcagggtccagccctgggaatgtcttggat
gtcttaactcaataccgaggcctgtcgtggagtgtgggcggagatgagaccatcgagacc
gtgaccaccctagccaacatcctccgggaattcaacccctccttgaagggcttctctgtt
ggcactgggaaagaaaacactccccgagcatccttcaaccaggccgtagcaggagccaaa
tctgatggcttagctgcccaggccaaaaagctggtgagcctgatgaaggatgacaagaca
ataaactttcaggaagactggaagataatcactgtgtttataggaggcaacgacctctgt
ggctcctgcaataacctggctcgcttttctccccaaaccttcacagacaacatcaagacg
gccctggacatcctccatgcagaggttccccgggcctttgtgaacatggtctcggtgatt
gagatcacccccttgagagaactgttcaatgaacctaaagtcagctgcccacggatgatc
ctcaggagcctgtgtccttgtgtcttgaaccttggtgagaactcagcagaacttgcccaa
cttgtggaaaggaacaggcagtatcaggaagaaactggaaaactgattgagagtggccga
tacgacaccagggatgacttcaccgtggtcctccagcccatgtttgaaaatgtcgtcatg
ccacggaccctggagggcttgcccgacagctctttctttgcccctgactgtttccacttc
aatgtcaagactcacgctcgctcagccatcgccctctggaagaacatgctagaacctgtg
ggccgcaagacaagacatcagaattttgaaatcaaggtccctatcatgtgtccaaaccag
acctcaccgtttctgagcaccaccaagaacagcaacctgggacatggaacttcgatgtct
tgtgaggagaaagccccctctgcctcaccaccaacctcagtgcataccctgagacctgca
gacatccaagttgtggcagctctgggagactctgtgactgctggcaatggaatcagctcc
caagaaggtgatctcgctgatgttaccacacagtatcgaggactgtcctacagtgctggt
ggggacaagttcctggagaatgtgaccaccttgcccaacatcctccgggaatttaatgga
aatctcacaggctactcagtcggaaccggtgacgtcaactctgcaagcgcgttccttaac
caggctgtccctggggcaaaggctgagaaccttgcaagtcaagtccagactctgattcag
aagatgaagaatgacaccagagtgaactttcaccaagactggaaggtcatcactgtgatg
attggggccagcgacttgtgtgacttctgcaaggattcgaatcgttactctgcagccaat
ttttctgaccatctccgcaatgccttggacatcctgcataaggaggtacccagagccctg
gtcaaccttgtggacttcatgaaccccagtatcattcggcaagtgttcctgaagaaccca
gacaagtgccctgtgaatcagaccagtgtcctgtgcaactgtgttctgaccccaggggag
gattcccatgagctggcaaggttggaggccttcaccaaatcctaccagagtagcatgctt
caactggttgagtcaggccgctacgacacccgggaggatttctctgtggtactgcagccc
tttctcttcaacatcaggctccccatcctagagaatgggaatccagatacatccttcttt
gccccagactgcatcctcctaagccagaagttccacactcagctcgcgagagccctttgg
gccaatatgcttgaacccctgggaaagaaaatggatactttggacccgaaagaactcata
gctttggcctgccccaccaaggacaagcccttcctgagaaccttccggaacagtaactac
acgtaccctatcaagccagccattgagaattggggcagtgacttcctgtgcacagagcag
agtccttccagcaaggtacccacctcagttcatgagctccgaccatcagacatcaaggtg
gtggcagcaatgggtgactttctgacgacagccaccggagctcgaccaagtgagtccagc
agtctagacaccccctggagggggctgtcttggagcattggaggagatggaacgttggag
acccataccacactgcccaacatcctgaagaagttcaacccttccatccttggattctcc
accggtaccctggagaacacggcaggattaaatgtggcagaagaaggcgccagagctcag
gacatgccggcccaggctcaggccctggtgaagaagatgaaaagcacccctacaatcaac
atacaggaagactggaagctgattacactcctcatcgggaacaacgacctgtgtctttac
tgtgaggatccggagaactactcaaccagggagtatgtcaagtacatccagcatgccttg
gacatcttctatgaggagcttcccagggttttcatcaacgtggtggaagtcatggagctg
tccggtctgctccacgaccagggcgggaaatgtgccatgccgttggctgtccagaaaaac
tgcagttgccttaaacgctctcaaaacctcatggcaatgcaggagctgaagaaagtcaac
gggaacctccagagtgccctctcggagctctcctactggcatcggtacatgcagcgtgag
gactttgcagtcactgtccagcctttcttccggaatacctttgtcccactggatgagcgt
gggggcctcgacctcactttcttctctgaagactgtttccacttctcagtccgtgggcat
gctgagatggccattgccctctggaacaacatgctggaaccagtgggcaagaagacaacc
tccaataacttcacatacaaccggaccaaactcaagtgtccctcgcctgaaaaccctttc
ctctacactgtccggaacagtcagattcttctagacaaggctaaagaaaactccaataca
ctctactgggcagtgccagtggctgcagtaggtggcctggtagttggcatccttggaatg
atgttgtggagaactgtgagactcgtccaatag

DBGET integrated database retrieval system