KEGG   Rattus norvegicus (rat): 192260Help
Entry
192260            CDS       T01003                                 

Gene name
Cdipt, Pis, Pis1
Definition
(RefSeq) CDP-diacylglycerol--inositol 3-phosphatidyltransferase
  KO
K00999  CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    192260 (Cdipt)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    192260 (Cdipt)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    192260 (Cdipt)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.11  CDP-diacylglycerol---inositol 3-phosphatidyltransferase
     192260 (Cdipt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-GeneID: 192260
NCBI-ProteinID: NP_620254
RGD: 620576
Ensembl: ENSRNOG00000024144
UniProt: P70500
Position
1q37
AA seq 213 aa AA seqDB search
MPEENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESH
KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWITA
PIALLKSIISVIHLVTAARNMAALDAADRAKKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaaatatcttcctgttcgtgcctaatcttattggttatgcccggattgtt
ttcgccatcatttccttctactttatgccctgctgccccttcacggcctcctccttctat
ctactcagcggacttctagacgctttcgatggacacgcagctcgagcccttaatcaagga
acccgatttggggccatgctcgacatgctgacggaccgttgcgccaccatgtgtctcttg
gtcaacctggccctgctctaccctcgggccactcttctgttccagctcagcatgagcctg
gacgtggccagtcactggctgcatctgcacagttctgtggtgcgaggcagtgagagccac
aagatgattgacctgtctgggaaccctgtgcttcgaatctactatacttccaggcctgct
ctgttcaccctgtgtgctggaaatgaactcttctactgcctcctgtacctgttcaatttc
tccgagggaccactagtcggctctgtggggcttttccgaatgggcctctggatcacagct
cccattgccctgctcaagtccatcattagtgtcatccacctcgtcacggctgcaaggaac
atggctgccctcgatgcagcagaccgcgccaagaagaaatga

DBGET integrated database retrieval system