KEGG   Rattus norvegicus (rat): 192262
Entry
192262            CDS       T01003                                 

Gene name
C1s
Definition
(RefSeq) complement C1s subcomponent precursor
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    192262 (C1s)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    192262 (C1s)
  09171 Infectious disease: bacterial
   05133 Pertussis
    192262 (C1s)
   05150 Staphylococcus aureus infection
    192262 (C1s)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    192262 (C1s)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    192262 (C1s)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192262 (C1s)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     192262 (C1s)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   192262 (C1s)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    192262 (C1s)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 HRM Trypsin_2 hEGF EGF
Other DBs
NCBI-GeneID: 192262
NCBI-ProteinID: NP_620255
RGD: 619983
Ensembl: ENSRNOG00000011971
UniProt: Q6P6T1
Position
4
AA seq 694 aa
MGKSPEMWCFVFFSLLASFSAEPTMYGEILSPNYPQAYPNEVVKTWDIEVPEGFGIHLYF
THLDMELSENCAYDSVQIISGGIEEERLCGQRTSKSPNSPIVEEFQFPYNRLQVVFTSDF
SNEERFTGFAAYYSAVDVNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRTCGVN
CSGDVFTALIGEIASPNYPNPYPENSRCEYQIRLQEGFRLVLTIRREDFDVEPADSEGNC
HDSLTFAAKNQQFGPYCGNGFPGPLTIKTQSNTLDIVFQTDLTGQNKGWKLRYHGDPIPC
PKEISANSIWEPEKAKYVFKDVVKITCVDGFEVVEGNVGSTSFYSTCQSNGQWSNSRLEC
QPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQEEGGEYHCAANGSWVNDQL
GVELPKCIPVCGVPTEPFKVQQRIFGGYSTKIQSFPWQVYFESPRGGGALIDEYWVLTAA
HVVEGNSDPVMYVGSTLLKIERLRNAQRLITERVIIHPSWKQEDDLNTRTNFDNDIALVQ
LKDPVKMGPTVAPICLPETSSDYNPSEGDLGLISGWGRTENRTNVIQLRGAKLPITSLEK
CQQVKVENPKARSNDYVFTDNMICAGEKGVDSCEGDSGGAFALPVPNVKDPKFYVAGLVS
WGKKCGTYGIYTKVKNYVDWILKTMQENSGPKKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagagatgtggtgctttgtcttcttttctcttttggcatcgttttct
gctgagcctaccatgtatggggagatcctgtcccctaattatccccaggcgtaccccaat
gaggtcgtgaaaacttgggacatagaagtcccagaggggtttgggattcacctttacttc
acccatctggacatggagctgtcagagaactgtgcatacgactcagtgcagataatctca
ggaggcatcgaggaagagagactctgtggccagaggaccagcaagagtcccaactccccc
attgtagaagagtttcaattcccatacaataggctccaggtggtctttacgtcagacttc
tccaacgaggaacggtttactggctttgcagcgtattactcagccgtagatgtaaatgaa
tgcacagactttacagatgtcccttgcagccacttctgcaataacttcattggtggatac
ttctgctcctgccccccagaatacttcctccacgatgacatgaggacttgtggggtcaac
tgtagtggggatgtattcactgccctgattggggagatcgcaagtcccaattatcccaac
ccatacccggagaactcaaggtgtgaataccagattcggctgcaggagggcttccgactg
gtgttgactatccggagagaagattttgatgtggaaccagctgactcagaggggaactgc
cacgacagtttgacttttgctgcaaaaaaccaacagtttggtccttactgtggcaatgga
ttccctggaccgctaactattaaaacccagagcaatactcttgatattgtctttcaaact
gacctaacggggcaaaataaaggctggaagcttcgttaccatggggatcccatcccctgt
cccaaagaaatcagtgctaattctatctgggagcccgaaaaggcaaaatacgtgttcaaa
gatgtcgtgaagataacctgtgtggatggattcgaagttgtggagggaaatgttggctca
acatcattctattccacttgtcaaagcaacggacagtggagcaattccaggctagagtgt
caacctgtggactgtggtgttccagaacccattgagaatggtaaagttgaagacccagaa
gacactgtattcggctccgtcatccactacacgtgcgaagagccatattactacatggaa
caggaagaaggcggagagtatcactgcgctgctaatgggagctgggtgaatgaccagctg
ggtgtcgagcttccaaaatgtattccagtctgtggagtacccaccgagccctttaaagta
cagcagaggatatttggaggatactctacaaagattcaaagttttccttggcaggtctac
tttgagtccccccgaggtggcggggctcttatcgatgagtactgggtgctgacggccgct
cacgttgtggagggaaactctgacccagtgatgtatgtcgggtccacacttctgaaaata
gagcggttgagaaatgcccagaggctcatcactgaacgtgtgattattcatcccagctgg
aaacaagaggacgacctgaatacacggacaaattttgacaatgacattgccctggtgcag
ctcaaagaccctgtgaaaatgggacccactgttgcccccatctgcctgccagaaacctcc
tcagactacaacccctcagagggtgacctggggctgatctctgggtggggccgaacagag
aatagaaccaatgttattcaactcagaggggcgaagttacccataacatctttagaaaag
tgccagcaggtgaaagtggaaaacccgaaagcgaggtcaaacgactatgttttcactgac
aacatgatctgtgctggggaaaagggtgtggacagctgtgagggtgacagcggaggggct
tttgctctgccggtccccaatgtcaaggaccccaaattctatgtggctggcctggtgtcc
tgggggaaaaagtgtgggacctatgggatctacacaaaggtaaagaactacgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaagaaggactga

KEGG   Rattus norvegicus (rat): 29687
Entry
29687             CDS       T01003                                 

Gene name
C1qb
Definition
(RefSeq) complement C1q subcomponent subunit B precursor
  KO
K03987  complement C1q subcomponent subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05133  Pertussis
rno05142  Chagas disease
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    29687 (C1qb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    29687 (C1qb)
  09171 Infectious disease: bacterial
   05133 Pertussis
    29687 (C1qb)
   05150 Staphylococcus aureus infection
    29687 (C1qb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    29687 (C1qb)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    29687 (C1qb)
  09164 Neurodegenerative disease
   05020 Prion disease
    29687 (C1qb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29687 (C1qb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    29687 (C1qb)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 29687
NCBI-ProteinID: NP_062135
RGD: 2229
Ensembl: ENSRNOG00000012749
UniProt: P31721 G3V7N9
Position
5
AA seq 253 aa
MKTQWSEILTPLLLLLLGLLHVSWAQSSCTGSPGIPGVPGIPGVPGSDGKPGTPGIKGEK
GLPGLAGDHGELGEKGDAGIPGIPGKVGPKGPVGPKGAPGPPGPRGPKGDSGDYKATQKV
AFSALRTVNSALRPNQAIRFEKVITNVNDNYEPRSGKFTCKVPGLYYFTYHASSRGNLCV
NIVRGRDRDRMQKVLTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGVEGANS
IFTGFLLFPDMDV
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagacacagtggagtgagatcttgacacccctgttgctgctgctcctgggtttgctc
catgtctcctgggcccaaagcagctgtactgggtcccctggcatccctggggtccctggc
atccctggggtccctggctctgatggcaaaccaggcactccagggataaaaggagagaaa
gggctccccggactggctggagaccatggtgagttaggagagaaaggggatgcagggatc
cctgggatcccaggcaaagttggccccaagggtcccgtcggccctaagggtgctccaggc
ccccctggaccccgcggtcccaaaggtgactctggagactacaaggctacccagaaagta
gccttctctgccctgaggacggtcaacagcgccctgcgaccaaaccaggccattcgcttt
gaaaaggtgatcaccaatgttaatgataactacgagccgcgcagtggcaagttcacctgc
aaggtacctggcctctactacttcacctaccacgccagttcccgcgggaatctgtgtgtg
aacatcgtgcgcggccgcgaccgagaccgcatgcagaaagttctcaccttctgcgactat
gcccaaaacaccttccaggtcaccacgggtggggtagtcttgaagctggagcaggaagag
gttgttcacctgcaggccacagacaagaactccctgctgggcgtcgagggagccaatagc
atcttcactggctttctgcttttccctgacatggatgtatga

KEGG   Rattus norvegicus (rat): 298566
Entry
298566            CDS       T01003                                 

Gene name
C1qa
Definition
(RefSeq) complement C1q subcomponent subunit A precursor
  KO
K03986  complement C1q subcomponent subunit A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05133  Pertussis
rno05142  Chagas disease
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    298566 (C1qa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    298566 (C1qa)
  09171 Infectious disease: bacterial
   05133 Pertussis
    298566 (C1qa)
   05150 Staphylococcus aureus infection
    298566 (C1qa)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    298566 (C1qa)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    298566 (C1qa)
  09164 Neurodegenerative disease
   05020 Prion disease
    298566 (C1qa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298566 (C1qa)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    298566 (C1qa)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 298566
NCBI-ProteinID: NP_001008515
RGD: 1306716
Ensembl: ENSRNOG00000012807
UniProt: P31720
Position
5
AA seq 245 aa
METSQGWLVACVLAVTLVWTVAEDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIR
TGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAI
RQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSR
GQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagacctctcagggatggctggtggcttgtgtgctggccgtgaccctggtatggaca
gtggctgaagatgtctgcagagcacccaacgggaaggacggggttgcaggaattcctggc
cgcccagggaggccgggtctcaaaggagagagaggggagccaggagctgccggcatccgg
accggtatccgaggtcttaaaggagacatgggggaatctgggccccctggcaaacccggc
aatgtggggttcccagggcccactgggcccctggggaacagcggcccccaagggttgaaa
ggtgtgaaaggcaatccgggcaatatcagggaccagccccggccagctttctcagctatt
cggcagaacccaccgacgtatggcaacgtggttgtctttgacaaggtcctcaccaaccag
gagaatccataccagaaccgcacaggtcacttcatctgtgcggtgcccggtttctattac
ttcaccttccaagtgatctccaagtgggacctttgtctgtctatcgtgtcctcctcccgg
ggccagcccaggaattcccttggtttctgtgacaccaacagcaaggggctcttccaggtg
ttagcagggggcactgtgcttcaattgcaacgaggggacgaggtgtggattgagaaggac
ccagcaaagggccgcatttaccagggtactgaagccgacagcatcttcagtggattcctc
atttttccctcggcctga

KEGG   Rattus norvegicus (rat): 312705
Entry
312705            CDS       T01003                                 

Gene name
C1r
Definition
(RefSeq) complement C1r subcomponent precursor
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    312705 (C1r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    312705 (C1r)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    312705 (C1r)
  09171 Infectious disease: bacterial
   05133 Pertussis
    312705 (C1r)
   05150 Staphylococcus aureus infection
    312705 (C1r)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    312705 (C1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    312705 (C1r)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312705 (C1r)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     312705 (C1r)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   312705 (C1r)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    312705 (C1r)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 312705
NCBI-ProteinID: NP_001128027
RGD: 1309091
Ensembl: ENSRNOG00000011796
UniProt: B5DEH7
Position
4
AA seq 707 aa
MRLIPLLLVTLFCGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPTGYRVKLVF
WQFDVEPSEGCFYDYVKISADKKTLGRFCGQQDSPQGNPPGRKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECTSQPNSVEEGLQPRCQHLCHNYVGGYFCSCRPGY
ELQKDRQSCQAECSSGLYTEPSGYISSLEYPKPYPPDLRCNYSIRVERGLTVHLKFLDPF
EIDDHQQVHCPYDQLQIYANGKNLGEFCGTQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKALDEFTIIQDPQPQYQFRDYFIVTCKQGYQLMEGSQALLSFTAVCQH
DGTWHRAMPRCKIKDCGQPRSLSNGDFRYLTTRGVNTYEARIQYYCHDPYYKMMTRAGSS
ESVRGIYTCTPQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKQRIIGGQKANPGNFPWQAF
TNIHGRGGGALLGDRWILTAAHTIYPKEHNKENNVNVSKDVFLGHTNVEEIKKLGHHPVR
RVIIHPDYRQDEPNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDKDLMGYVSGFGI
TEDKIAFNLRFVRLPIADREACQRWLRTKNSNDVFSQNMFCSGDPTLKHDACQGDSGGVF
AVRDRSRDIWVATGIVSWGIGCGEGYGFYTKLLNYVDWIKKEIGDEN
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgcgtctcatccccctcctcctggtgaccctgttctgtggggtggagggctccatctac
ctccctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagt
gacttggagacgaccaccgtgatcactgtccccacggggtacagggtgaagctggtcttc
tggcagtttgatgtggagccttctgaaggctgtttctatgactacgtcaagatttctgct
gataagaaaactctggggaggttctgtgggcagcaggattctcctcagggcaacccccca
ggaaggaaggaattcatgtcccaaggaaacaagatgctgctgacctttcacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggct
gtggaccttgatgaatgtacgtcccagcccaactcagtggaggagggtttgcagccccga
tgccaacacctgtgccacaactatgttggaggttacttctgttcctgccgtcctggctac
gagcttcagaaagacaggcaatcctgccaggccgagtgcagcagtgggctctacacggag
ccctcgggctacatctccagcctcgagtacccgaagccctatccacccgatctgcgctgt
aactacagcatccgggtagagaggggcctcactgtgcacctcaagttcctggatcctttt
gaaattgatgaccaccagcaagtacactgcccctatgaccagctccagatctacgctaat
gggaagaacttgggtgaattctgtggaacgcaaaggcctccagaccttgacaccagcagc
aacgccgtggatctgctgttcttcacggatgagtccggggacagccgaggctggaagctt
cgctacaccactgaaatcatcaagtgcccccaacccaaggccctggatgagttcaccatc
atccaggatccacagcctcagtaccagttccgggattacttcattgtcacctgcaaacaa
ggctaccagctcatggagggaagtcaggcgctgctctccttcacggctgtttgccagcat
gatggcacgtggcaccgtgccatgcccaggtgcaagatcaaggactgtggacagccccgc
agcctgtctaatggggacttccgctacctcaccacaagaggcgtgaacacctatgaagcc
aggatccagtattactgccatgacccatattacaagatgatgaccagagctggcagcagc
gagtccgtacgagggatatatacctgcacaccccaaggcatttggaagaacgaagaggaa
ggagagaaaatgccccggtgtctgccagtatgtgggaagcctgtcaaccccgtgacacag
aagcagcgcatcatcggagggcagaaagccaatccgggcaacttcccctggcaggcattc
accaatatccacgggcgagggggcggggccctgcttggagaccgctggatcctcacggca
gcccacaccatctaccccaaggaacacaacaaagaaaacaacgtcaacgtcagtaaagat
gttttcctgggccacacaaacgtggaagagatcaaaaaactgggacatcaccctgtccgt
cgggtcatcatacacccagactaccgccaagatgagcctaacaattttgaaggagacatt
gccctactggagctggaaaacagtgtcacactgggtcccaacctcctccccatctgtctc
ccagacaatgagaccttctatgacaaagaccttatgggttatgtcagcggcttcgggata
acagaagataaaatagcttttaatctcaggtttgtccgtctgcccatagccgatcgagag
gcatgccagaggtggctccggacgaaaaacagtaatgatgtattttctcaaaatatgttc
tgttctggggacccaactctcaagcatgacgcctgccagggggacagtgggggtgttttt
gcagtcagggaccgcagtcgtgatatctgggtggctacaggcatcgtatcctggggcatt
gggtgtggtgagggatacggcttttacaccaagttactgaattatgttgactggatcaag
aaagagattggagatgaaaactga

KEGG   Rattus norvegicus (rat): 362634
Entry
362634            CDS       T01003                                 

Gene name
C1qc
Definition
(RefSeq) complement C1q subcomponent subunit C precursor
  KO
K03988  complement C1q subcomponent subunit C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05133  Pertussis
rno05142  Chagas disease
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    362634 (C1qc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    362634 (C1qc)
  09171 Infectious disease: bacterial
   05133 Pertussis
    362634 (C1qc)
   05150 Staphylococcus aureus infection
    362634 (C1qc)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    362634 (C1qc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    362634 (C1qc)
  09164 Neurodegenerative disease
   05020 Prion disease
    362634 (C1qc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362634 (C1qc)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    362634 (C1qc)
SSDB
Motif
Pfam: C1q Collagen BclA_C TNF
Other DBs
NCBI-GeneID: 362634
NCBI-ProteinID: NP_001008524
RGD: 1306828
Ensembl: ENSRNOG00000012804
UniProt: P31722
Position
5
AA seq 245 aa
MVVGTSCQPQHGLYLLLLLLALPLRSQANAGCYGIPGMPGLPGTPGKDGHDGLQGPKGEP
GIPAIPGTQGPKGQKGEPGMPGHRGKNGPMGTSGSPGDPGPRGPPGEPGEEGRYKQKHQS
VFTVTRQTAQYPAANGLVKFNSAITNPQGDYNTNTGKFTCKVPGLYYFVHHTSQTANLCV
QLLLNNAKVTSFCDHMSNSKQVSSGGVLLRLQRGDEVWLAVNDYNGMVGTEGSDSVFSGF
LLFPD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggttgtaggaaccagctgccagccccagcatggactctacctgctgctgctccttctg
gccctacccctcaggagccaggccaacgctggctgctatgggatcccagggatgccaggc
ctgccgggaacccctgggaaggatgggcatgatggacttcaggggcccaagggtgagccg
ggaatcccagccatccctgggacacaaggacccaagggtcagaagggcgagccgggtatg
cctggccatcgtgggaaaaacggccccatggggacctctgggtcgccaggggatccaggc
cccaggggtcctcccggggagccgggtgaggagggtcgatacaaacagaagcatcagtcg
gtgttcacggtcacccggcagaccgcgcagtacccagcggccaatggccttgtcaagttc
aattccgccatcaccaatcctcagggggattacaacacaaacacggggaagttcacctgc
aaagtgcccggcctctactacttcgtccaccacacatcccagacggccaacctgtgcgtg
cagctgctcctcaacaatgccaaggtgaccagcttctgcgaccacatgtccaacagcaag
caggtcagctcaggaggagtactcctgcggctgcagaggggcgacgaggtgtggctggcc
gtcaacgactacaacggcatggtgggcactgagggctctgacagcgtcttctctggtttc
ctactgtttcctgactag

DBGET integrated database retrieval system