KEGG   Rattus norvegicus (rat): 192273Help
Entry
192273            CDS       T01003                                 

Gene name
Slc22a25, Slc22a9, Ust1, Ust1r
Definition
(RefSeq) solute carrier family 22, member 25
  KO
K08206  MFS transporter, OCT family, solute carrier family 22 (organic anion/cation transporter), member 9/10/19/24/25
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    192273 (Slc22a25)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   192273 (Slc22a25)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    192273 (Slc22a25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 192273
NCBI-ProteinID: NP_620263
RGD: 621104
Ensembl: ENSRNOG00000017964
UniProt: O70609
Position
1q43
AA seq 552 aa AA seqDB search
MAFQDLLNQVGSLGRFQILQMTFILIFNIIISPHSLLENFTAVIPNHRCWVPILDNDTVS
GNDNGNLSQDDLLRVSIPLDSDLRPEKCRRFVQPQWDLLHLNGTFSSVTEPDTEPCVDGW
VYDQSTFLSTIITEWDLVCESQSLDSIAKFLFLTGILVGNILYGPLTDRFGRRLILICAS
LQMAVTETCAAFAPTFLIYCSLRFLAGISFSTVLTNSALLIIEWTRPKFQALATGLLLCA
GAIGQTVLAGLAFTVRNWHHLHLAMSVPIFFLLVPTRWLSESARWLIMTNKLQKGLKELI
KVAHINGMKNSTDVLTIEVVRTIMKEELEASQTKSSLWDLFRTPNLRKRICLLSLVRFVV
WLSVIGLLINFQHLRINVFLLQCLLGIITIPANLVGIFLVNHLGRRISQLFIISLFGISI
LAIIFVPQEMQILRMVLATFGGVFSFVSVSSALVHANELLPTIIRATALGVIGIAGSTGA
ALSPLFMILRTYSDSLPWIIYGVLSFLGGLVVLLLPETKNQPLPDSIQDVENEGRASRQG
KQNDTLIKVTQF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcaggacctcctgaatcaagttggcagcctggggaggttccagatccttcag
atgactttcattttgatcttcaacataataatttctcctcattctctattggagaacttc
acagcagtcattcccaatcatcgctgctgggtccccatcctcgacaatgacactgtctct
ggtaatgacaatgggaacctgagccaagatgacctcctgagggtctctatccccctggac
tccgatctgagaccagagaagtgtcgtcgctttgtccaaccacagtgggatctccttcat
ctaaacggtaccttttccagtgtgacagagccagacacagagccctgtgtggatggctgg
gtgtatgaccaaagcacctttctttccaccattattaccgagtgggacctggtgtgtgaa
tctcagtcactggattcaatagctaagtttctattcttgactggtatcttagtaggaaat
atcctatatggccccttaacagacaggtttgggaggaggttaatccttatatgtgcctca
ctgcaaatggccgtcactgaaacctgtgcagcttttgctcccacctttctcatctactgc
tcactacgattcctggcagggatttccttctcaaccgttttgaccaatagtgccttgctc
attatagaatggacaaggcctaaattccaagccttggcaacaggactgctattatgtgct
ggagcaattggacagacagtattggcaggcctggcttttactgtgcgaaactggcaccac
ctccatctggcaatgtctgtaccaatatttttcttacttgtacccacaaggtggctgtca
gagtcagcgcggtggctgattatgaccaacaaactccagaagggcttaaaagaacttata
aaagttgcacacataaatggaatgaagaattcaacagatgtcctaaccattgaggttgtg
agaacaatcatgaaggaggagctggaggcctcacagacaaaatcttccctgtgggacttg
ttccgtacacctaacttgcgtaagcggatatgccttctgtcccttgtgagatttgtggta
tggttatctgtgattggtttactgatcaacttccagcacctaaggatcaatgtcttccta
ttgcagtgtcttcttggtataatcaccattccagccaatttagttggaatttttttggtg
aatcacttgggtcgcagaataagtcaactatttatcatatccctgtttggaatttccatt
ttggccataatatttgtgcctcaagaaatgcagatcctgcgcatggttttggcaactttt
ggaggagtattttcttttgtctctgttagcagtgctcttgtgcatgcaaatgagctactt
cccactataatcagggcaactgctttaggagtcattggaattgctggtagtactggggca
gccctgtctcctctgtttatgatccttaggacatactctgactccttgccctggatcatc
tatggagtcctttccttccttggtggccttgttgtccttctcctccctgagaccaagaat
cagcctctgcctgactccatacaggatgtggaaaatgaaggaagagcctccagacaagga
aagcagaatgatactctcatcaaagtgacacagttttaa

DBGET integrated database retrieval system