KEGG   Rattus norvegicus (rat): 192275Help
Entry
192275            CDS       T01003                                 

Gene name
Dad1
Definition
(RefSeq) defender against cell death 1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
rno04141  Protein processing in endoplasmic reticulum
Module
rno_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    192275 (Dad1)
   00513 Various types of N-glycan biosynthesis
    192275 (Dad1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    192275 (Dad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAD
Motif
Other DBs
NCBI-GeneID: 192275
NCBI-ProteinID: NP_620265
RGD: 621028
Ensembl: ENSRNOG00000009090
UniProt: P61805
Position
15p13
AA seq 113 aa AA seqDB search
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgtctgtggtgtccgtcatctcccggttcctggaggagtacttgagctccact
ccacagcggctgaagttgctggatgcctatctcctttatatattgctgaccggggcgctg
cagttcggctactgtctcctcgtgggcaccttccccttcaactctttcctctctggcttc
atctcttgtgtgggcagcttcatcttagcggtttgcttgagaatacagatcaacccccag
aacaaggcggatttccaaggcatctctcctgagcgagcctttgctgattttctctttgcc
agcactatcctgcacctcgtcgtcatgaacttcgtcggctga

DBGET integrated database retrieval system