KEGG   Rattus norvegicus (rat): 192281
Entry
192281            CDS       T01003                                 

Gene name
Oas1a
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 1A
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    192281 (Oas1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    192281 (Oas1a)
   05171 Coronavirus disease - COVID-19
    192281 (Oas1a)
   05164 Influenza A
    192281 (Oas1a)
   05162 Measles
    192281 (Oas1a)
   05168 Herpes simplex virus 1 infection
    192281 (Oas1a)
   05169 Epstein-Barr virus infection
    192281 (Oas1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     192281 (Oas1a)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Other DBs
NCBI-GeneID: 192281
NCBI-ProteinID: NP_620268
RGD: 621760
Ensembl: ENSRNOG00000001369
UniProt: Q05961
Position
12
AA seq 358 aa
MEQELRSTPSWKLDKFIEVYLLPNTSFRDDVKSAINVLCDFLKERCFRDTVHPVRVSKVV
KGGSSGKGTTLKGKSDADLVVFLNNFTSFEDQLNRRGEFIKEIKKQLYEVQREKHFRVKF
EVQSSWWPNPRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSLYSNPDPKIYTILISECIS
LGKEGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVY
AWERGNGITEFNTAQGFRTILELVTKYQQLRIYWTKYYDFQHPDVSKYLHRQLRKSRPVI
LDPADPTGNVAGGNQEGWRRLASEARLWLQYPCFMNRGGSPVSSWEVPVDEAWSCILL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagcaggaactcaggagcaccccgtcctggaagctggacaagttcatagaggtttac
ctccttccaaacaccagcttccgtgatgatgtcaaatcagctatcaatgtcctgtgtgat
ttcctgaaggagagatgcttccgagatactgtccacccagtgagggtctccaaggtggtg
aagggcggctcctcaggcaaaggcaccacactcaagggcaagtcagacgctgacctggtg
gtgttccttaacaatttcaccagctttgaggatcagttaaacagacggggagagttcatc
aaggaaattaagaaacagctgtatgaggttcagcgtgaaaaacattttagagtgaagttt
gaggtccagagttcatggtggcccaacccccgggctctgagcttcaagctgagtgcacca
cacctccaacaggaggtggagtttgatgtgcttccagcctatgatgtcctaggtcatgtt
agcctctacagcaatcctgatcccaagatctacaccatcctcatctccgaatgtatctcc
ctggggaaggagggcgagttctctacctgcttcacggagctccagaggaacttcctgaag
cagcgcccaaccaagcttaagagtctcatccgcctggtcaagcactggtaccaactgtgt
aaggagaagctggggaagccgctgcccccacagtacgccctggagctgctcacggtctat
gcctgggaacgtggaaatggaattactgagttcaacacagctcagggcttccggacaatc
ttggaactggtcacaaagtaccagcagcttcgaatctactggacaaagtattatgacttt
caacacccagatgtctccaaatacctacacagacagctcagaaaatccaggcctgtgatc
ctggaccctgctgacccaacagggaacgtggctggtgggaaccaagaaggctggcggcgg
ttggcctcagaggcgaggctgtggctgcagtacccatgttttatgaacaggggtggttcc
ccagtgagctcctgggaagtgccggtggatgaggcctggtcatgcatcctgctgtga

KEGG   Rattus norvegicus (rat): 246268
Entry
246268            CDS       T01003                                 

Gene name
Oas1b
Definition
(RefSeq) inactive 2'-5'-oligoadenylate synthase 1B
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246268 (Oas1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246268 (Oas1b)
   05171 Coronavirus disease - COVID-19
    246268 (Oas1b)
   05164 Influenza A
    246268 (Oas1b)
   05162 Measles
    246268 (Oas1b)
   05168 Herpes simplex virus 1 infection
    246268 (Oas1b)
   05169 Epstein-Barr virus infection
    246268 (Oas1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246268 (Oas1b)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2
Other DBs
NCBI-GeneID: 246268
NCBI-ProteinID: NP_653353
RGD: 708393
Ensembl: ENSRNOG00000033220
UniProt: Q5BKD0
Position
12
AA seq 379 aa
MEQELRSIPASKLDQFIEVHLPDISFRDELREVIDVLCILLKNRCCRESSHPVRTSKVGK
GGSSRKGTTLKGWSDADLVVFLDSFTCFGDQLNRRGEFTKEIKKLLFEVQRDRHIGVKIE
VHSSWSPNHRALSFKLSAPDQQKEVKFDVLPAYDLLGHVCIPRKPNPQFYANLISERTSL
GKEDEFSTCFTELQLYFLNWRPTKLKSLIRLVKHWYQLCKEKLGDPLPPQYALELLTIYA
WERGGRLTKFNTAQGFRTVLELITKYKQLLIYWTVCYDFQHPEVSKYLRRQLKKPRPVIL
DPANPTGNIAGSNPKGWRRLAGEAAAWLRYPCFKYKDGFPVCPWDVPTEVDIPSQNYFFH
IICLIFWLLLRLIFGKHSV
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggagcaggaactcaggagcatcccggcctcgaagctcgatcagtttatagaggttcat
cttcccgacatcagcttccgtgatgaactcagagaagtcatcgatgtcctgtgtatcctc
ctgaagaatagatgctgcagggagtcttcccacccagtgaggacctccaaagtgggaaag
ggcggctcctcacgcaaaggcaccacgctcaagggctggtcagacgctgacctggtggtg
ttccttgacagtttcacttgctttggggatcagttaaaccgacgcggagagttcaccaag
gaaattaagaaactactgtttgaggttcagcgtgacagacatattggagtgaagatcgag
gtccacagttcatggagtcccaaccatcgggctctgagcttcaagctgagtgcccctgac
cagcagaaggaggtgaagtttgatgtgcttccagcctatgatttactgggtcatgtttgt
atccccaggaagcccaacccacaattctacgccaatctcatcagtgagcgcacctctctg
gggaaggaggacgagttctctacctgcttcacggagctccagctgtacttcctgaattgg
cgcccaaccaagctcaagagtctcatccgcctggtcaagcactggtaccaactgtgtaag
gagaagctgggggatccactgcccccacagtatgccctggagctgctcacgatctatgcc
tgggagcgtgggggtagattaactaagttcaacacagcccagggcttccggacagtcttg
gaactgatcaccaagtacaagcaacttctaatctactggactgtgtgttatgactttcaa
cacccagaggtctccaaatacctgcgcagacagctcaaaaaacccaggcctgtgatcctg
gacccggctaacccaacaggaaacattgctggttcgaacccaaagggctggaggcgacta
gcaggagaggctgctgcctggctgcggtacccatgctttaagtacaaggacggttttcca
gtgtgtccctgggatgtgccgacggaggttgatataccaagccagaattacttttttcat
attatctgcctaattttttggttactgcttcgattgatttttgggaagcattctgtatag

KEGG   Rattus norvegicus (rat): 304507
Entry
304507            CDS       T01003                                 

Gene name
Oas1i
Definition
(RefSeq) 2 ' -5 ' oligoadenylate synthetase 1I
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    304507 (Oas1i)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    304507 (Oas1i)
   05171 Coronavirus disease - COVID-19
    304507 (Oas1i)
   05164 Influenza A
    304507 (Oas1i)
   05162 Measles
    304507 (Oas1i)
   05168 Herpes simplex virus 1 infection
    304507 (Oas1i)
   05169 Epstein-Barr virus infection
    304507 (Oas1i)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     304507 (Oas1i)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS PDR_CDR DZF
Other DBs
NCBI-GeneID: 304507
NCBI-ProteinID: NP_001009680
RGD: 1359379
Ensembl: ENSRNOG00000047076
UniProt: Q5MYX1
Position
12
AA seq 382 aa
MGHGLSSISASELDKFIEVYLLPNTSFGADVKLAINVVCDFLKERCFRGAAHPVRVSKVV
KGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQRERHFGVKF
EVQSSWWPNPRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSIYSMPDPQIYASLIRKCMY
LGKEGEFSTCFTELQRNFLKRRPTKLKSLIRLVKYWYHLCKEKLGKPLPPQYALELLTVY
AWERGNGFVDFETAQGFRAVLELIIKYQELRIYWTTYYNFQHQEVSNYLHTQLTRIRPVI
LDPADPTGNIAGSNPEGWRRLAGEAAAWLRYPCFKYKDGSPVCPWDVPMEVDVPYQEDHF
FRNFCLFFLFLFLFIFWRVSCV
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggcacggactcagcagtatctcagcctcggagctggacaagttcatagaggtttac
ctccttccaaacaccagctttggtgctgacgtcaaattagcgatcaatgtcgtgtgtgat
ttcctgaaggagagatgcttccgaggtgctgcccacccagtgagggtctccaaggtggtg
aagggtggctcctcaggcaaaggcaccacactcaagggcaagtcagacgctgacctggtg
gtgttccttaacaatctcaccagctttgaggatcagttaaacagacggggagagttcatc
aaggaaattaagaaacagctgtatgaggttcaacgtgaaagacattttggagtgaagttt
gaggtccagagttcatggtggcccaacccccgggctctgagcttcaagctgagtgcacca
cacctccaacaggaggtggagtttgatgtgcttccagcctatgatgtcctaggtcatgta
agcatctacagcatgcctgacccccaaatctatgccagtctcatcaggaagtgcatgtac
ctggggaaggagggcgagttctctacctgcttcacggagctccagaggaacttcctgaag
cggcgcccaaccaagctgaagagtctcatccgcctggtcaagtactggtaccatctgtgt
aaggagaagctggggaagccgctgcccccacagtacgccctggagctgctcacggtctat
gcctgggagcgtggaaatggatttgtcgattttgagacagcccagggcttccgggcagtc
ttggaactgatcataaagtaccaggagcttagaatctactggacaacctattataacttt
cagcaccaagaggtctccaactacctgcacacacagctcacaagaatcaggcctgtgatc
ctggacccggctgacccaacaggaaacattgctggttcgaacccagagggctggaggcga
ctagcaggagaggctgctgcctggctgcggtacccatgctttaagtacaaggacggttcc
ccagtgtgtccctgggatgtgccgatggaggttgacgtgccgtaccaggaggatcacttt
tttcgtaatttttgtctattttttttgtttttgttccttttcatattttggagggtttct
tgtgtatag

KEGG   Rattus norvegicus (rat): 363938
Entry
363938            CDS       T01003                                 

Gene name
Oas2
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    363938 (Oas2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    363938 (Oas2)
   05171 Coronavirus disease - COVID-19
    363938 (Oas2)
   05164 Influenza A
    363938 (Oas2)
   05162 Measles
    363938 (Oas2)
   05168 Herpes simplex virus 1 infection
    363938 (Oas2)
   05169 Epstein-Barr virus infection
    363938 (Oas2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     363938 (Oas2)
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2 Polbeta DZF
Other DBs
NCBI-GeneID: 363938
NCBI-ProteinID: NP_001009715
RGD: 1359697
Ensembl: ENSRNOG00000049282
UniProt: Q5MYU0
Position
12
AA seq 733 aa
MGNWMPGWSSSGSLGVPPMPVQKLEKSVQVNLEPDEKCLSQTEVSSVPSQKLEEYIQANL
KPDEESLKQIDQAVDAISDLLCSEVMIDVLKVVKGGSYGRKTVLRDCSDGTLVLFTGLFK
QFQDQKKYQDKLLDLIEQRLKSHEKYKKSVKRKLSLLEVQVSIPGQSILLQLLPTFNPLC
ISENPSAQVYQNLKRSMDQVKASPGEFSDCFTTLQQRFFEKYPGRLKDLILLVKHWYKQL
QDKWIIPSPPPLLYALELLTVYAWEQGCQTKDFDITQGIRTVLQLISQPTNLCVYWLDNY
NFEDETVRNNLLHQLNSPRPVILDPTDPTNNVGKDDRFWQLLAEEAQEWLNSLRLNKPHK
PCWDVLPMPFFITPSHCLDKFIKDFLQPDKVFLNQIKRAVDIICSFLKETCFQNSDIKVL
KIIKGGSTAKGTALQQRSDADIIVFLSSLDSYDSLETERSQYVQEIRKQLEACQKAFNLG
VKFDISKWMAPRVLSFTLESKSLKQSVEFDVLPAYDALGQLRSDYTSRLKAYKKLIELYA
SQDSLKGGEFSVCFTELQRDFIETRPTKLKGLIRLIKHWYKQCERKMKPKASLPPKYALE
LLTVYAWEHGSGTDGFDTAEGFRTVLDLVIRYRQLCVFWTVNYNFEEDHMRKFLLTQIQK
KRPVILDPADPTGDVGGGDRWCWHLLAKEAKEWLSSSCFQVEPKSPVQPWKVPVVQTPGS
CGAQIYPVVGGVY
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgggaaactggatgcctggctggtcatccagtgggtctttgggggtgccccccatgcca
gtgcagaagctagaaaagtctgtccaggtaaaccttgaaccagatgaaaaatgtctgagt
cagaccgaggtgtcctctgtaccatcccagaagctagaagaatatatccaggcaaacctc
aaacccgatgaagaatctctgaagcagatagaccaggctgtggatgccatctctgacctg
ctgtgcagtgaggtgatgatcgatgtgctgaaagtggttaagggtggctcctatggtcgg
aaaacagtcctaagagactgctccgatggtacacttgttctcttcaccggtctcttcaaa
cagttccaagaccagaagaaataccaagataagctccttgacttgattgaacaacggctg
aaaagccatgagaaatacaagaagtcagtaaaacgtaaacttagcctccttgaagtacaa
gtgtctataccagggcagagtatactcttgcagttgcttccaaccttcaatcctctgtgc
atcagtgagaatcccagcgcccaggtctatcagaatctcaaaagatccatggatcaagta
aaagcatcacctggggaattctcagactgcttcaccacactgcagcagaggtttttcgag
aaatatcccgggagactgaaggatttgattctattggtcaagcactggtataaacagttg
caggataagtggataataccctcacctccgccattgctatatgcactggagctgcttact
gtgtatgcctgggaacagggctgccagactaaagactttgacatcacgcaaggtatcagg
actgtgctgcaactcatcagtcagccgacaaacctgtgtgtctactggttagacaattac
aactttgaggatgagacagtccggaacaaccttctgcaccagctcaactccccaagaccg
gtcatcttggatccaaccgacccaaccaacaatgtgggcaaagatgacaggttctggcag
ctactggcagaagaggctcaggagtggctgaactctctcagactgaataagccacacaaa
ccatgttgggatgttctgcccatgccatttttcatcaccccaagccactgcctggacaag
ttcatcaaagacttcctccaacctgacaaggtcttcctaaaccaaatcaaaagagctgtt
gacattatctgttcattcttaaaagagacctgcttccagaattctgacatcaaagtcctg
aagatcatcaagggaggatccactgccaaaggcacagctctgcagcagagatcagatgct
gacatcatagtgttcctcagctcactggatagttatgactccctagaaactgaacgctcc
cagtacgtccaggagatccgaaagcagttagaagcctgccagaaggcctttaatttaggg
gtgaagtttgatatttccaaatggatggcccccagggtgctgagttttaccctggaatcc
aagagtctcaagcaaagtgtggagttcgatgtccttcccgcctatgatgcactaggtcag
ctgcggtctgactacacctccaggctcaaagcctacaagaagctcattgagctgtatgcc
tcacaggacagcctcaaaggaggggagttttcagtctgttttacagagctacagagagac
ttcattgaaaccaggcccaccaaactcaagggtctgatccgcctgatcaagcactggtac
aaacagtgtgaaaggaagatgaagccaaaagcatctttgcctccaaagtacgcactggag
ctgctcaccgtgtatgcgtgggagcatggcagtggcacagatggcttcgacactgctgaa
ggcttccggaccgtcctggacttggtcataagataccggcagctctgcgtcttctggaca
gtcaattacaactttgaggaggatcacatgaggaagttcctactgacccagatccagaaa
aagaggcctgtgatcctggatccagcagatcccacaggtgatgtgggaggaggtgaccgc
tggtgttggcatcttctagccaaagaagcaaaggagtggctgtcctcctcctgtttccaa
gtggagccaaaaagccccgtgcagccgtggaaagtaccagtagtacagactccaggaagc
tgtggagctcagatctaccctgtggtgggtggggtgtactaa

KEGG   Rattus norvegicus (rat): 494202
Entry
494202            CDS       T01003                                 

Gene name
Oas3
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    494202 (Oas3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    494202 (Oas3)
   05171 Coronavirus disease - COVID-19
    494202 (Oas3)
   05164 Influenza A
    494202 (Oas3)
   05162 Measles
    494202 (Oas3)
   05168 Herpes simplex virus 1 infection
    494202 (Oas3)
   05169 Epstein-Barr virus infection
    494202 (Oas3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     494202 (Oas3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Other DBs
NCBI-GeneID: 494202
NCBI-ProteinID: NP_001009493
RGD: 1359319
UniProt: Q5MYT7
Position
12
AA seq 1137 aa
MDLYHTPAGALDKLVAHSLHPAPEFTAAVRRALGSLDNVLRKNGAGGLQRPRVIRIIKGG
AHARGTALRGGTDVELVIFLDCLRSFGDQKTCHTEILGAIQALLESWGCNPGPGLTFEFS
GPKASGILQFRLASVDQENWIDVSLVPAFDALGQLHSEVKPTPNVYSSLLSSHCQAGEHS
ACFTELRKNFVNIRPVKLKNLILLVKHWYRQVQTQVVRATLPPSYALELLTIFAWEQGCR
KDAFSLAQGLRTVLALIQRNKHLCIFWTENYGFEDPAVGEFLRRQLKRPRPVILDPADPT
WDLGNGTAWCWDVLAKEAEYSFNQQCFKEASGALVQPWEGPGLPCAGILDLGHPIQQGAK
HALEDNNGHLAVQPMKESLQPSNPARGLPETATKISAMPDPTVTETHKSLKKSVHPKTVS
ETVVNPSSHVWITQSTASSNTPPGHSSMSTAGSQMGPDLSQIPSKELDSFIQDHLRPSSQ
FQQQVRQAIDTILCCLREKCVDKVLRVSKGGSFGRGTDLRGKCDVELVIFYKTLGDFKGQ
NSHQTEILCDMQAQLQRWCQNPAPGLSLQFIEQKSNALHLQLVPTNLSNRVDLSVLPAFD
AVGPLKSGAKPLPETYSSLLSSGCQAGEHAACFAELRRNFINTRPAKLRSLMLLVKHWYR
QVAARFEGGETAGAALPPAYALELLTVFAWEQGCGEQKFSMAEGLRTVLRLVQQHQSLCI
YWTVNYSVQDPAIRAHLLRQLRKARPLILDPADPTWNMDQGNWKLLAQEAAALESQVCLQ
SRDGNLVPPWDVMPALLHQTPAQNLDKFICEFLQPDRHFLTQVKRAVDTICSFLKENCFR
NSTIKVLKVVKGGSSAKGTALQGRSDADLVVFLSCFRQFSEQGSHRAEIIAEIQAQLEAC
QQKQRFDVKFEISKRKNPRVLSFTLTSKTLLGQSVDFDVLPAFDALGQLKSGSRPDPRVY
TDLIQSYSNAGEFSTCFTELQRDFISSRPTKLKSLIRLVKHWYQQCNKTVKGKGSLPPQH
GLELLTVYAWERGSQNPQFNMAEGFRTVLELIGQYRQLCVYWTINYGAEDETIGDFLKMQ
LQKPRPVILDPADPTGNLGHNARWDLLAKEAAAYTSALCCMDKDGNPIKPWPVKAAV
NT seq 3414 nt   +upstreamnt  +downstreamnt
atggacctgtaccacacgccagccggagctctggacaagctggtggcccacagcctgcac
ccagcccctgagttcacagcggctgtgcggcgtgctctggggtccctggacaacgtccta
aggaagaacggagccggagggttacagagaccaagggtgataaggatcatcaagggagga
gcccatgctcgaggcacagctctcagaggtggcactgatgtcgaactcgtcatcttcctc
gactgcctccggagctttggcgaccagaagacctgtcacacagagatcctgggcgccata
caagcattgctggagtcctgggggtgcaaccctgggcctggcctgacttttgagttttct
gggccaaaggcgtctggcatcttacagtttcgcctggcatcggtggaccaagaaaactgg
atagatgttagcctggtgcctgccttcgatgccctaggacagctccactctgaagtcaag
ccaacacccaatgtgtactcctccctcctcagcagccactgccaggctggggaacactca
gcctgcttcacagagctccggaagaactttgtgaatatccgcccagtcaaacttaagaac
ttaatcctgctggtcaaacactggtaccgccaggtgcagacacaggttgtgagagccaca
ctgccccctagctacgcgctggagctgctcaccatctttgcctgggagcagggctgtagg
aaggatgccttcagcctggcccaagggctccggactgtcctggccttgatccaacgcaac
aagcatctctgcattttctggacggaaaactacggcttcgaagaccctgcagttggggag
ttcttgcgaaggcagcttaagagacccaggcccgtgatcctggatccagctgacccaaca
tgggacttgggcaatgggacagcctggtgctgggatgtgcttgccaaggaggctgaatac
agctttaaccagcagtgcttcaaggaggcctcaggagcccttgtgcaaccttgggagggg
ccgggccttccatgtgctgggatcttggatttgggtcaccctatccaacaaggagctaag
catgcccttgaagacaacaatggccaccttgctgttcagccaatgaaagagagcctacaa
ccatcaaatccagcccgaggactcccagaaacagccaccaagatctccgctatgccagac
ccaacggtcactgaaacccacaagagcctcaaaaaatcagtgcacccaaagactgtcagt
gaaacagtggtgaatccctcaagtcatgtttggatcacccagagtacagcatcctcaaac
acgcctccgggccactctagtatgtccaccgctgggtcacagatgggcccagatctgtca
cagatccccagcaaggagctggactccttcatccaggaccacctcaggccgagttcccag
ttccagcagcaggtgaggcaggccatcgacaccatcctgtgctgcctccgggagaagtgt
gtagacaaagtcttgagagtcagcaagggtggctcttttggccgtggcacagacctcagg
ggcaaatgtgatgtggagcttgtcatcttttataaaactctcggggacttcaagggccag
aactcacaccagacagagatcctgtgtgacatgcaggcccagctgcagcgctggtgtcag
aacccagcacctggactgagcctccagtttattgaacagaagtccaatgctctgcatctt
cagctggtgcccaccaacctcagcaaccgggtagacctcagtgtgctgcccgcttttgat
gcagtggggccgctgaagtccggcgccaaacctctacccgagacgtactcctccctcctc
agcagcggctgccaggctggggagcatgcagcctgcttcgcagagctccgaaggaacttc
ataaacactcgccctgccaaacttaggagcctgatgctactggtcaaacactggtaccgc
caggttgccgctcgatttgaaggaggagagacagcaggtgctgctctgcccccagcctat
gccctggagctcctgacagtctttgcctgggaacaaggctgcggagaacaaaagtttagc
atggctgaaggcctgcggactgtcctgaggctggtccagcagcaccagtcactctgtatc
tactggacagtcaactacagtgtgcaggacccagccatcagagcacaccttctccgccag
cttcggaaagccaggcctctaatcctagaccctgcagatcccacctggaacatggaccag
ggcaactggaagttgctggctcaggaggcggctgccctggagtcacaagtctgccttcag
agtagggatgggaatctggtgccaccatgggatgttatgccagccctccttcaccagacc
ccggctcagaacctggacaagttcatctgtgaattcctccagcctgaccgccatttcctg
actcaggtgaagagagcagtggacaccatatgttccttcctgaaagaaaactgcttccgg
aattctaccatcaaggtgctcaaggtggtcaagggtgggtcttctgccaaaggcactgct
ctacaagggcgctcggatgctgacctggtggtgttcctcagctgcttccgccagttctct
gaacaaggcagccatcgggcagagatcatcgcggagatccaggctcagctggaggcgtgt
cagcagaagcagaggttcgatgtcaagtttgagatctccaagaggaagaacccccgagtt
ctcagcttcacgctgacatccaagacgctgctaggccagagcgtggacttcgatgtgctg
ccagccttcgatgctcttggtcagctgaagtccggctctcggccagatccccgggtctac
acggacctcatccagagctacagtaatgcaggagagttctctacctgcttcacggagctg
cagcgggacttcattagctcccgtcccaccaaactcaagagtctgatccgtctggtgaaa
cactggtaccaacagtgtaacaagacagtcaaggggaagggttccttgcccccccagcac
gggctggagctcctgactgtgtacgcctgggagcgaggcagccagaacccccagttcaac
atggcggagggcttccgcacagttctggagctgattggccagtaccgtcagctgtgcgtc
tattggaccatcaactacggtgcagaagacgagaccatcggagacttcctgaagatgcag
cttcagaagcccaggcctgtcatcctggacccagctgacccgacaggcaacctaggccac
aatgcccgctgggacctgcttgccaaggaggctgcagcatacacatctgccctgtgctgc
atggacaaggacggcaaccccatcaagccatggccagtaaaggccgctgtgtga

DBGET integrated database retrieval system