KEGG   Rattus norvegicus (rat): 192348Help
Entry
192348            CDS       T01003                                 

Gene name
Fnbp1
Definition
(RefSeq) formin binding protein 1
  KO
K20121  formin-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192348 (Fnbp1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    192348 (Fnbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FCH SH3_1 SH3_9 SH3_3 SH3_2 HR1 Lzipper-MIP1 SH3_16
Motif
Other DBs
NCBI-GeneID: 192348
NCBI-ProteinID: NP_620269
RGD: 621350
Ensembl: ENSRNOG00000008258
UniProt: Q8R511
Position
3p12
AA seq 620 aa AA seqDB search
MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSK
EEEEYKYTACKAFLSTLNELNDYAGQHEVISENMTSQITVDLVRYVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQMRQ
QMAEDSKADYSLILQRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQ
VIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SSSKEGKPELKFGGKSRGKLWPFIKKNKLMTLLTSPHQPPPPPPASASPSAVPNGPQSPK
QQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGVTPEDFSNFPPEQRRKKLQQKVDDL
NKEIQKETDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVTQNIEKLRLEAHKFEAWLAE
VEGRLPARSEQARRQSGLYDGQTHQTVTNCAQDRESPDGSYTEEQSQESEHKVLATDFDD
EFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLSVIEEDKGDGWTRIRRNEDEEGYV
PTSYVEVYLDKNAKGAKTYI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagctggggcactgagctctgggatcagtttgacaacttggaaaaacacacacagtgg
ggaatcgacattcttgagaaatacatcaagttcgtcaaggagagaacggagattgagctc
agctatgccaaacagctcaggaatctttcaaagaaataccaacccaagaagaactcgaag
gaagaagaggaatacaagtacacggcgtgtaaagcgtttctttccaccctgaatgagttg
aatgactacgccgggcagcatgaggtcatctccgagaacatgacgtcacagatcacggtg
gacctggtgcgctacgtacaggagctgaagcaggagaggaaatcgaatttccatgatgga
cggaaggctcagcagcacatagagacgtgctggaagcagctggagtcgagtaagaggagg
tttgagcgggactgtaaggaggccgaccgtgcacagcagtactttgagaaaatggacgcc
gacatcaatgtgaccaaggcggatgtggaaaaggcgcgacaacaagctcagatgcgccag
caaatggcagaggacagcaaagctgattactccttaatcctgcagaggttcaaccaggag
cagtgggagtactaccacacccacatccccaacatcttccagaaaatccaagagatggag
gagaggaggattgtgcgcattggagagtccatgaagacgtatgcagaggtggaccggcag
gtgatacccatcatcgggaagtgcctggacggtatagtgaaggcggccgagtctattgac
cagaaaaacgactcccagctagtcgtagaagcctataagtcaggattcgagcctcccgga
gacattgaattcgaagattacacacagcccatgaaacgcacggtgtcagacaacagcctt
tccagttccaaagaaggcaagcccgagctcaagtttggaggcaagtccagaggcaagctc
tggccgttcatcaagaaaaacaagcttatgacccttttaacatccccccaccagcctccc
cctcctccccctgcctctgcctcaccctctgctgttcccaacggcccccagtctcccaag
cagcaaaaggaacccctctcccaccgcttcaacgagttcatgacctccaaacccaaaatc
cactgcttccggagcctaaagcgtgggctttcgctcaagctgggtgtcaccccggaagac
ttcagcaacttcccgcctgagcagagaaggaaaaaactacaacagaaagtggacgatctc
aataaagagatccaaaaggagaccgaccagagagacgccatcactaaaatgaaagatgtg
tacctaaagaaccctcagatgggagacccggccagcttggaccacaaactcgccgaagtc
acccagaacatagaaaaactgcggctggaggctcacaagttcgaggcctggctggctgag
gtggaaggcagactcccagctcggagtgagcaggcacgccggcaaagtgggctgtacgac
ggccagacacaccagacggtcactaactgcgcccaggaccgggagagcccagatggtagt
tacacagaagagcaaagccaggagagcgagcacaaggtgctggccacggacttcgacgat
gagttcgacgatgaggagccgcttcctgccatcgggacctgcaaggccctctacaccttt
gaaggtcagaacgaaggcaccatttcggtagttgaaggagaaacgctgagcgtgattgag
gaggacaaaggcgatgggtggacacgcatccgcagaaacgaagacgaggagggttacgtc
cccacttcctacgtcgaagtctatttagacaaaaacgccaaaggtgctaagacttatatt
taa

DBGET integrated database retrieval system