KEGG   Rattus norvegicus (rat): 192646
Entry
192646            CDS       T01003                                 

Gene name
Mtnr1b, Mel1b-r
Definition
(RefSeq) melatonin receptor 1B
  KO
K04286  melatonin receptor type 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    192646 (Mtnr1b)
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    192646 (Mtnr1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    192646 (Mtnr1b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Melatonin
    192646 (Mtnr1b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 192646
NCBI-ProteinID: NP_001094111
RGD: 620798
Ensembl: ENSRNOG00000008972
UniProt: P49287
Position
8q12
AA seq 364 aa
MPDNSSIANCCAASGLAARPSWPGSAEAEPPETPRAPWVAPMLSTVVIVTTAVDFVGNLL
VILSVLRNRKLRNAGNLFVVNLALADLVVALYPYPLILVAILHDGWVLGEIHCKASAFVM
GLSVIGSVFNITAIAINRYWCICHSATYHRACSQWHAPLYISLIWLLTLVALVPNFFVGS
LEYDPRIYSCTFIQTASTQYTMAVVAIHFLLPIAVVSFCYLRIWILVLQARRKAKAERKL
RLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQIPEGLFVTSYFLAYFN
SCLNAIVYGLLNQNFRREYKRILSALWSTGRCFHDASKCHLTEDLQGPVPPAAMATIPVQ
EGAL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcctgacaacagctccatcgccaactgctgtgcggccagcgggctggcagcgcgccct
agttggcccgggtcagcggaggcggagccccctgagactccccgggcaccctgggtggct
cccatgctatctacagtagtcattgtcaccacagctgtggacttcgtggggaacctgctt
gtgatcctctcggtgctcaggaaccgcaagctgcggaacgcaggtaatttatttgtggtg
aatctggccttggctgacctggtggtagccctgtacccttacccactcatccttgtggcc
attctccatgacggttgggtacttggggagatccactgtaaggccagtgcctttgtgatg
ggcctgagtgtcattggctctgtcttcaacatcacagccattgccatcaaccgctactgg
tgcatctgtcacagtgcgacctaccaccgagcctgcagtcagtggcatgctcccctctac
atcagcctcatctggcttctcactctggtggccttggtgcccaatttctttgtggggtct
ctagaatatgacccgcgaatctattcctgcaccttcatccagacagccagcacccaatac
actatggctgtggtggccatccacttcctccttccaattgctgtggtgtccttttgctac
ctgcgaatatggatactggtgctccaggcccgaaggaaggcaaaggctgagagaaagcta
cgcctgagacccagtgacctgcgcagtttcctaaccatgttcgcagtgtttgtggttttc
gccatatgctgggcccccctcaactgtattggccttgcagtggccatcaatccagaggca
atggctcttcagatcccagaagggctttttgtcaccagttacttcctagcttacttcaac
agctgccttaatgctattgtttatgggcttctgaaccagaacttccgcagggagtacaag
aggatcctctcggccctctggagcactgggcgctgcttccatgatgcttccaaatgccac
ctgactgaggatttgcagggcccagtgccacctgctgccatggccaccatacctgtccag
gaaggtgctctctag

DBGET integrated database retrieval system