KEGG   Rattus norvegicus (rat): 192647
Entry
192647            CDS       T01003                                 

Gene name
Mfn1
Definition
(RefSeq) mitofusin-1
  KO
K21356  mitofusin 1 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04621  NOD-like receptor signaling pathway
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    192647 (Mfn1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    192647 (Mfn1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    192647 (Mfn1)
   05022 Pathways of neurodegeneration - multiple diseases
    192647 (Mfn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    192647 (Mfn1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     192647 (Mfn1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    192647 (Mfn1)
SSDB
Motif
Pfam: Fzo_mitofusin Dynamin_N MMR_HSR1 FadA
Other DBs
NCBI-GeneID: 192647
NCBI-ProteinID: NP_620432
RGD: 621460
Ensembl: ENSRNOG00000011057
UniProt: Q8R4Z9
Position
2
AA seq 741 aa
MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIATEDDLVEIQGY
RNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDG
DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSP
GTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD
ASASEPEYMEDVRRQHMERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMP
EGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNV
AAAEKRVYSMEEREDQIDRLDFIRNQMNLLTMDVKKKIKEVTEEVANKVSCAMTDEICRL
SVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTSEVNASILQSQQEIIENL
KPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTN
AQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGII
VVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVKF
TSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAV
QLERELENFSKQFLHPSSGES
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcagaaacggtatctccactgaagcacttcgtgctggcaaagaaggccatcactgcg
atcttcggccagttactggagtttgttactgagggctcacattttgttgaagcaacatac
aggaacccggaacttgatcggatagcaaccgaggatgatctggtggagatacagggctac
agaaacaagctcgctgtcattggggaggtgctgtctcggaggcatatgaaagtggcattt
tttggcaggacaagtagtggcaagagctctgtcatcaacgcaatgctgtgggataaagtc
ctccccagcgggattggtcacacaaccaactgcttcctgagtgtggagggaactgatgga
gataaagcctaccttatgaccgaagggtcagatgagaagaaaagcgtgaagactgttaat
cagctggcccatgccctccatatggataaagacttgaaagctggttgtcttgtgcacgta
ttttggcccaaagcaaaatgtgccctcttgagagatgacctggttttagtagacagccca
ggtacagatgtcaccacagagctggacatctggattgataagttctgccttgatgctgat
gtttttgttttggtggcaaactcggaatcaacgctgatgaacacggagaaacattttttc
cataaggtgaatgagcggctctccaagccaaacatttttatcctgaataatcgttgggat
gcttctgcttcagagccagaatatatggaggatgtgcgcagacagcacatggaaagatgt
cttcacttcttggtagaagagctcaaggttgtgagtcctttagaagctcggaatcggatc
ttttttgtttcagccaaggaagttctcaactccagaatgaataaagcccaggggatgcca
gaaggtggaggggcacttgcagaaggatttcaggcaagattacaggagtttcaaaatttt
gaacaaacttttgaggagtgtatctcgcagtcagcagtgaaaacaaagtttgaacagcac
actatcagagctaaacagatactagacactgtgaaaaacatactggactcagtaaacgtg
gcagcagcagagaagagggtttattcaatggaagagagggaagaccaaatcgacagactg
gactttattcgaaaccagatgaaccttttaacaatggatgttaagaagaagatcaaggag
gtcacggaggaggtggcaaacaaggtttcttgtgcaatgacagatgagatttgtcgcctg
tctgttttggttgatgagttttgttctgagtttcatcctacccccagtgtgctgaaagtg
tataagagtgaattaaataagcacatagaagatggcatgggaagaaatttggctgatcgg
tgcaccagtgaagtcaatgcctccattcttcaatctcagcaagaaatcattgaaaatttg
aagccactacttccagctggtatacagaataaacttcatacattaatcccttgcaaaaag
tttgatctcagctatgatctcaattgccacaagctgtgttcggattttcaagaagacatt
gtgtttcggttttccctgggctggtcttcccttgtacatcgattcctgggttctacgaat
gcacagagggtgctgcttgggctgtcagagcctatctttcaggtccctagatctttagct
tcaactcctactgctccttctaacccagcagcaccagataatgcagcccaggaagagctc
atgatcacactgatcacaggattggcatccctcacgtctagaacctccatgggcatcata
gttgttgggggcgtgatttggaaaacagtgggctggaaactcatctctgtcaccttaagt
atgtatggagctttgtacctttatgaaagactgacttggactactcgtgcgaaagagaga
gcgtttaagcagcagtttgtaaactatgcaactgaaaaactgcagatgattgtgaagttc
acaagtgcaaactgcagccaccaagtccagcaagaaatggccaccacttttgctcgactg
tgccaacaagttgatgttactcagaaacatctggaagaagaaattgctagattatccaaa
gagattgaccaactggagaaaatacaaaacaattcaaagctcttaagaaataaagctgtt
caacttgaacgtgagctggaaaatttttcgaagcagtttctccacccgagcagtggagaa
tcctaa

KEGG   Rattus norvegicus (rat): 64476
Entry
64476             CDS       T01003                                 

Gene name
Mfn2
Definition
(RefSeq) mitofusin-2
  KO
K06030  mitofusin 2 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04621  NOD-like receptor signaling pathway
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    64476 (Mfn2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64476 (Mfn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    64476 (Mfn2)
   05022 Pathways of neurodegeneration - multiple diseases
    64476 (Mfn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64476 (Mfn2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    64476 (Mfn2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     64476 (Mfn2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    64476 (Mfn2)
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    64476 (Mfn2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    64476 (Mfn2)
SSDB
Motif
Pfam: Fzo_mitofusin Dynamin_N MMR_HSR1 Synaptobrevin
Other DBs
NCBI-GeneID: 64476
NCBI-ProteinID: NP_570964
RGD: 628843
Ensembl: ENSRNOG00000046424
UniProt: Q6IRL2
Position
5
AA seq 757 aa
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESAGFLEDT
HRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK
VLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVS
VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF
FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDR
IFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ
HTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK
QMTEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD
RCSTAIASSLQTMQQDMIDGLKPLLPVSVRNQIDMLVPRQCFSLSYDLNCDKLCADFQED
IEFHFSLGWTMLVNRFLGPKNSRRALLGYNDQVQRPLPLTPANPSMPPLPQGSLTQEELM
VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTRAKERA
FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKK
VEALDSLQSKAKLLRNKAGWLDSELNMFIHQYLQPSR
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtccctgctcttttctcgatgcaactccatcgtcaccgtcaagaaggataagcgacac
atggctgaggtgaatgcttcccctctcaagcactttgtcactgccaagaaaaagatcaat
ggcatctttgagcagctgggggcctacatccaagagagtgccggcttccttgaagacacc
cacaggaatacagaactggacccagttactacagaagagcaggtcctggatgtcaaaggg
tacctgtccaaggtcaggggaatcagcgaggtgctggccaggcggcacatgaaggtggct
ttttttggccggacgagcaatgggaagagcaccgtgatcaatgccatgctttgggacaaa
gttctgccatctgggattggccacaccaccaattgcttcctgcgggttgggggcacggat
ggccacgaggccttcctcctcacggagggctcagaagagaagaagagtgtcaagaccgtg
aaccagctagcccatgccctccatcaggatgagcagctgcatgcaggcagcctggtgagt
gtgatgtggcccaactccaagtgtccacttctgaaggatgacctcgtgctgatggacagc
cctgggatcgatgtcaccacggagctggacagctggattgataagttttgcctggatgct
gatgtgtttgtactggtggccaactcagagtccacgctgatgcagacggagaagcagttc
ttccacaaagtgagtgagcgtctctcccggcccaacatcttcatcctgaacaaccgctgg
gatgcgtctgcctcggagcctgagtacatggaggaggtgcggcggcagcacatggaacgc
tgcaccagctttctggtggatgagctaggcgtggtggatcgagctcaggccggggaccgg
atcttctttgtgtctgccaaggaggtgctcagtgccagggtccagaaagcccagggcatg
ccagaaggaggtggcgctcttgcagaaggttttcaagtgaggatgtttgagtttcagaat
ttcgagaggcgatttgaggagtgcatttcccagtctgcagtaaagaccaaatttgagcag
cacacagtccgggccaagcagattgcagaggccgtccgtctcatcatggattccctgcac
attgcggctcaggagcagcgggtttattgtcttgaaatgcgggaagagcggcaagaccgg
ctgagattcattgacaagcagctggagctcctggctcaagactataagctacggattaag
cagatgacagaggaagtggaaaggcaggtgtccacagccatggctgaagagatcaggcgc
ctctctgtgctggttgacgagtaccagatggactttcacccatccccagttgtcctcaag
gtttataagaatgaactgcaccgccatatagaggaaggcctgggacgaaacatgtctgac
cgctgctccacagccattgccagttcactgcagactatgcagcaagacatgatagacggc
ttgaagccccttcttcctgtgtctgtgcggaatcagatagacatgctggtccctcgacag
tgtttctccctcagctatgacctgaactgtgacaagctgtgcgctgactttcaggaggac
atcgaattccatttctcccttggatggactatgctagtgaataggttcctgggccctaag
aatagccggcgggccttgctgggctacaatgatcaggttcagcgtcctctccctctgaca
cctgccaaccccagcatgccacccttgccacagggctccctcacccaggaggagctcatg
gtctccatggttactggcctggcctctctgacttccaggacctctatgggcattctcgtg
gtcggaggagtggtgtggaaggcagtgggctggagactcatcgccctctcctttggactg
tatggcctcctgtacgtgtatgagcggctgacctggaccaccagagccaaggagagggcc
ttcaagcgccagtttgtggagtatgccagtgagaagctgcagctcattatcagttatacc
ggctctaactgcagccaccaagttcagcaagaattgtctgggacatttgctcatctgtgc
cagcaagttgacatcacccgggataatctggagcaggaaattgctgccatgaacaagaaa
gttgaggctctggattcacttcagagcaaagccaaattgctcaggaataaagctggctgg
ttggacagcgaactcaacatgttcatacaccagtacctgcagcccagcagatag

DBGET integrated database retrieval system