KEGG   Rattus norvegicus (rat): 207119Help
Entry
207119            CDS       T01003                                 

Gene name
Rin1
Definition
(RefSeq) Ras and Rab interactor 1
  KO
K17638  Ras and Rab interactor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    207119 (Rin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    207119 (Rin1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    207119 (Rin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS9 SH2 RA
Motif
Other DBs
NCBI-GeneID: 207119
NCBI-ProteinID: NP_620607
RGD: 620006
Ensembl: ENSRNOG00000050223
UniProt: P97680
Position
1q43
AA seq 798 aa AA seqDB search
MCTPVPWGLDSLPESQEKLKELPAMEDPGETEAHPLGATSLNFVPGYQQEEKPSPDPLYD
TPDARGVQAGGSQQPARTVSLRERLLITRPVWLQLRANAAAALHVLRTEPPGTFLVRKSN
TRQCQTLCVRLPEASGPSFVSSHYLQESPGGISLEGSELTFPDLVQLICAYCHTRDILLL
PLPLPRAIHQAATHKELEAISHLGMEFWSSSLNTKNQQRPSEAPQIPRLKARSPQELDQG
TGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGTSSSQ
TERLPPRQLLQRESSVGYRVPGSASGPSLPPLPSLQEVDCCSPSSSEEEGSSGSPTTSPR
LSRPRHRRPLLRSMSSAFCSLLAPERQVGRAATMLMQNRYTAVGQLVQDLLTQVRVGPES
RELQGIRQALSRARAMLSAELGPEKLLPPERLELVLEKSLHRSVLKPLRPILAARLRRRL
STDGSLGRLAEGFRLARTQGPGAFGSHLNLSSPVEIEPVRQKLLQLLRAYSPSAQIKWLL
QACKLLYTALKTQAGENAGADEFLPLLSLVLAQCDLPDLLLEAEYMSELLEPTLLTGEGG
YYLTSLSASLALLSGLSQAHALPLSPAQELQRSLALWEQRRLPATHNFQHLLRVAYQDPS
TGCTSKTLAVPPGSSIATLSQLCATKFRVTQPDAFGLFLYKDQGYHRLPPEALVHRLPTT
GYLIYRRAERPETQRAATEKTKTGNERPERGAWEEEKGGLNGEGKSEIAVDQEGKDQARG
GHMQLEEQKAEGCPALEE
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacgcctgtgccttgggggttggattctcttcctgagtcccaggagaagctgaag
gagctcccagccatggaagaccctggtgagaccgaagcacaccctctgggagccaccagc
ctgaactttgtacctgggtaccaacaggaagaaaagccatctccagacccactgtatgac
acacctgatgccagaggggttcaggcaggcgggtcccaacaaccagcacgcacagtgagc
ttgcgggagcggctgctgatcacccggcctgtgtggttacagctgcgggccaacgctgca
gccgcactgcacgtgctgaggacagagcctccggggaccttcctggtgcggaaatctaac
actcgccagtgccagactctatgtgtgcggctgccagaagctagtggcccctcttttgtc
tccagccactatctccaagagagtcctggcggcatctctttggagggctcagagctcaca
ttcccggacctggtccagctcatctgtgcatactgtcataccagggacattcttctcctc
cctctcccgctccccagagccattcatcaggcagccacccacaaagagctggaggccatc
tcccatctgggcatggagttctggagttcctctctcaacaccaagaaccaacagagacct
tcagaagctccgcagataccccggctgaaggctcgctcccctcaagagctggatcagggc
actggtgcagccctctgcttcttcaaccccctcttccccggggatctgggccccaccaaa
cgtgagaaattcaagaggagtttcaaagtgcgtgtatccacagagacctccagccctctg
tctccacctgctgtgccgcctcctccagtccccgttctgccagggacatcttccagccaa
acggaaagactgccccctcgacagctgctgcagagggagagctcagtgggataccgtgtg
ccaggaagtgcttctggtcctagtcttcctcccctaccttcacttcaggaggtggactgc
tgctcccccagcagctcagaggaggagggttcttcaggaagccctacaacctccccacgc
ctaagccgcccaaggcaccggcggcctctgcttcggtccatgagttctgctttctgctct
ctgctggcaccagagaggcaggtgggccgggcagctacaatgctaatgcaaaaccgatac
acagctgtgggtcagctagtgcaggacctattgacccaggttcgtgttggtcctgagtcc
cgggagttgcagggcatccgacaggccctgagtcgggcacgggccatgctgagtgcagag
ctgggccctgagaaactgctaccaccagagcggctggaattggtcctggagaaatccctg
catcgctctgttctcaagcctcttcgacccattctagctgcccgcctgcggcgccgactt
tccacagacggttcccttggccgcctagctgagggcttccgcctggcccggacccagggg
cctggagccttcgggtcccacctgaacctttcttccccagtggagatagaaccagtgcgt
cagaagctgctgcagctccttcgtgcctactcgcctagtgcccagatcaagtggctcctg
caggcctgcaagttgctatacacagccctgaaaacccaggcaggggagaatgcaggtgct
gatgagttcctgcctctcttgagccttgtcttggcccagtgcgaccttcctgacctcctg
ttagaagctgagtatatgtcagagctactggaacccacattgctcactggggagggcggc
tactacctgaccagcctctcagccagcctggccttgttgagtggcctaagccaggcccac
gcactgccactcagccctgcccaggagctccaacgttctctggccctctgggaacagcgc
cgcctgccggccacccacaacttccagcacctcctccgagtagcctaccaggaccccagc
acaggttgcacctccaagaccttggctgtgcccccggggtcttcgattgccaccctgagt
caactctgtgccaccaagttccgagtgacccaaccggatgcatttggcctctttctctac
aaggaccagggctaccatcgcctgccccctgaagccctagtccacaggcttcccacaact
ggttacctcatctaccgccgggcagagcgccccgagacccagagggctgcaacagagaag
accaagacaggaaatgagaggccagagcgaggagcatgggaggaggagaaagggggtcta
aatggtgaagggaaatctgagatagctgttgaccaagaaggcaaggatcaggccagagga
ggtcacatgcagctagaggaacaaaaggcagagggatgcccggctttagaagagtag

DBGET integrated database retrieval system