KEGG   Rattus norvegicus (rat): 207123Help
Entry
207123            CDS       T01003                                 

Gene name
RGD621098, Lin-10, Lin10
Definition
(RefSeq) similar to RIKEN cDNA D230025D16Rik
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0183
Motif
Other DBs
NCBI-GeneID: 207123
NCBI-ProteinID: NP_620609
RGD: 621098
Ensembl: ENSRNOG00000014668
UniProt: O08654
Position
19q11
AA seq 422 aa AA seqDB search
MLDLEVVPERSLGNEQWEFTLGMPLAQAVAILQKHCRIIKNVQVLYSEQSPLSHDLILNL
TQDGIKLLFDAFNQRLKVIEVYDLTKVKLKYCGVHFNSQAIAPTIEQIDQSFGATHPGVY
NSAEQLFHLNFRGLSFSFQLDSWTEAPKYEPNFAHGLASLQIPHGATVKRMYIYSGNSLQ
DTKAPMMPLSCFLGNVYAESVDVIRDGTGPSGLRLRLLAAGCGPGVLADAKMRVFERAVY
FGDSCQDVLSMLGSPHKVFYKSEDKMKIHSPSPHKQVPSKCNDYFFNYFTLGVDILFDAN
THKVKKFVLHTNYPGHYNFNIYHRCEFKIPLAIKKENAGGQTEICTTYSKWDSIQELLGH
PVEKPVVLHRSSSPNNTNPFGSTFCFGLQRMIFEVMQNNHIASVTLYGPPRPGAHLRTAE
LP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctggacctggaggtggtgcctgaacgctctctggggaacgagcaatgggaattcaca
ctgggaatgcctctggctcaggcagtagccattcttcagaagcactgtcgcatcatcaaa
aatgtccaggttctctacagtgagcagtctcctctaagccatgacctcatccttaacctg
actcaagacgggatcaagctactgtttgatgctttcaatcagagacttaaggtgattgaa
gtttatgacttaacaaaagtaaagttaaagtattgtggagtgcattttaactctcaggcc
atcgctcctaccattgagcaaattgaccagtcttttggtgcaacccatccaggagtgtac
aactctgctgagcagctcttccacctcaacttcagaggactgtctttctcttttcagtta
gactcatggacggaggctcccaagtatgagcccaattttgcccatggtctagcttctctt
cagataccccatggagcaactgtaaaacgaatgtacatttatagtggaaacagcctccag
gataccaaggctcctatgatgcccctgagctgtttcctggggaatgtatatgctgaaagt
gtagacgttattcgagacggaactggaccctcagggttgcgacttcgcttgctcgctgca
ggttgtggacccggagtattggcagatgccaaaatgagagtatttgagcgtgcggtgtat
tttggtgattcttgccaagatgttcttagcatgcttggctctccacacaaagtcttctat
aaatctgaagacaagatgaaaattcactctccttcccctcataaacaagttccatccaag
tgcaatgactacttttttaactatttcactcttggagtggacatcctgtttgatgcaaat
acacacaaagtgaagaagtttgtcctgcataccaattaccctgggcattataattttaac
atttaccaccgctgtgagttcaagatcccactagccataaagaaagaaaatgcaggtggt
caaaccgaaatatgcacaacctacagcaagtgggacagcatccaggagcttctgggccat
cctgtggaaaagccggttgtcttgcacagatcctcatccccaaataacaccaacccattt
ggctctacattctgctttggtcttcagcggatgatctttgaggtcatgcagaacaaccac
attgcctcagtgaccctgtatggcccccctaggcctggtgcccacctgagaacagcagag
ctgccctaa

DBGET integrated database retrieval system