KEGG   Rattus norvegicus (rat): 24158Help
Entry
24158             CDS       T01003                                 

Gene name
Acadm, MCAD
Definition
(RefSeq) acyl-CoA dehydrogenase, C-4 to C-12 straight chain
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
Module
rno_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
rno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    24158 (Acadm)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    24158 (Acadm)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    24158 (Acadm)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     24158 (Acadm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 24158
NCBI-ProteinID: NP_058682
RGD: 2012
Ensembl: ENSRNOG00000009845
UniProt: P08503 G3V796
Position
2q45
AA seq 421 aa AA seqDB search
MAAALRRGYKVLRSVSHFECRAQHTKPSLKQEPGLGFSFELTEQQKEFQTIARKFAREEI
IPVAPDYDKSGEYPFPLIKRAWELGLINTHIPESCGGLGLGTFDACLITEELAYGCTGVQ
TAIEANSLGQMPVIIAGNDQQKKKYLGRMTEQLMMCAYCVTEPSAGSDVAGIKTKAEKKG
DEYVINGQKMWITNGGKANWYFVLTRSNPDPKVPASKAFTGFIVEADTPGIHIGKKELNM
GQRCSDTRGITFEDVRVPKENVLIGEGAGFKIAMGAFDRTRPTVAAGAVGLAQRALDEAT
KYALDRKTFGKLLVEHQGVSFLLAEMAMKVELARLSYQRAAWEVDSGRRNTYFASIAKAF
AGDIANQLATDAVQIFGGYGFNTEYPVEKLMRDAKIYQIYEGTAQIQRLIIAREHIEKYK
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcgctccgcagaggctacaaggtcctgagaagtgtctctcattttgagtgt
cgagcacaacacacaaaaccatctctcaagcaggagccgggactagggtttagcttcgag
ttgacggagcagcagaaagagtttcaaacaattgctcggaagtttgccagagaggaaata
atcccggtcgccccagactacgataaaagcggggaatacccgttccctctcatcaagaga
gcctgggaacttgggttgatcaacacacacattccggagagttgtggtggtcttggcctg
ggaacttttgatgcgtgtttaattacggaagagttggcatatgggtgtacaggggtgcag
actgctattgaagcaaattctttggggcaaatgcctgtgattattgctggaaatgatcaa
cagaagaagaagtatttggggaggatgacggagcagctgatgatgtgtgcctactgcgtg
acagaaccctcagcaggctctgatgtggcgggcattaagaccaaagcagagaagaagggt
gatgaatatgtcatcaatggccagaagatgtggataaccaacgggggaaaggccaactgg
tattttgtattgacgcgatctaacccagatcctaaagtacctgctagtaaagccttcacc
ggattcatcgtggaggccgacaccccgggaatacacatcggaaaaaaggaactaaacatg
ggtcagcggtgctctgacaccagaggaatcaccttcgaagatgtcagagtgcctaaggaa
aatgtgttaattggtgaaggagcaggtttcaagattgcaatgggggcttttgatagaacc
aggccgacggtcgcagctggtgctgtcgggctagcccagagagccctggacgaagctact
aagtatgccctggacaggaaaacatttggaaagctgctagtggagcaccaaggagtttca
tttctgctcgcagaaatggcgatgaaagttgaactggccagactcagttaccagcgagca
gcctgggaggttgactccggccgccggaacacgtactttgcctctattgcgaaggccttt
gctggagatattgccaaccagctcgctaccgatgctgtgcagattttcggaggctatgga
ttcaacactgagtacccagtagaaaagctgatgcgggacgccaagatctatcagatttac
gaaggtactgcacaaattcagaggctgatcatagctcgtgagcacattgaaaagtataaa
aattaa

DBGET integrated database retrieval system