KEGG   Rattus norvegicus (rat): 24159Help
Entry
24159             CDS       T01003                                 

Gene name
Acly, ACL, Clatp
Definition
(RefSeq) ATP citrate lyase
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    24159 (Acly)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24159 (Acly)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     24159 (Acly)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24159 (Acly)
  Exosomal proteins of bladder cancer cells
   24159 (Acly)
  Exosomal proteins of melanoma cells
   24159 (Acly)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA CoA_binding ATP-grasp_2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 24159
NCBI-ProteinID: NP_058683
RGD: 2018
Ensembl: ENSRNOG00000016924
UniProt: P16638 G3V888
Position
10q31
AA seq 1101 aa AA seqDB search
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWAHLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLVGVNLSLDGVKSWLKPRLGHEATVGKAKGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDTKAQKLLVGVDEKLNAEDIKRHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYILDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSATLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYV
SRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPVVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVAKGAIVPAQEVPPPTVPMDYSWARELGLIRKPASF
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQRRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDFVKQHFPATPLLDYALEVEKITTSKKPN
LILNVDGFIGVAFVDMLRNCGSFTREEADEYVDIGALNGVFVLGRSMGFIGHYLDQKRLK
QGLYRHPWDDISYVLPEHMSM
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaggcaatttcagagcagaccggcaaagaactcctttacaagtacatctgt
accacctcagccatccagaaccggttcaagtatgcccgggttactcccgacacagactgg
gcccatctcctgcaggaccacccctggctgcttagccagagcttggtagtcaagccggac
cagctgatcaaacgtcgaggaaagcttggtctagtcggggtcaacctctctctggatgga
gtcaaatcctggctgaaacctcgactgggacatgaggccaccgtcggcaaggccaaaggc
ttcctcaagaactttctgattgagcccttcgtcccccacagtcaggcggaggagttctac
gtgtgcatctatgctacccgggaaggagactacgtcctgttccaccatgaagggggtgtg
gatgtgggcgatgtggacaccaaagcccagaagctgcttgtgggtgtggacgagaaactg
aacgctgaagacattaagagacacctgttggtccacgcccccgaagacaagaaagaaatc
ctggccagcttcatctccggcctattcaatttctacgaagatctttacttcacctacctt
gagatcaacccccttgtggtgaccaaagatggtgtctacatccttgacctggcggccaag
gtggacgccactgctgactacatctgcaaagtcaagtggggtgatatagagttccctccc
ccctttgggcgtgaggcatacccagaggaagcctacattgcagacctggatgccaaaagt
ggggcgagcttgaagctgaccttgctgaaccccaaggggcggatctggaccatggttgcc
gggggtggcgcctctgtcgtgtacagtgataccatctgtgatcttggaggtgtcaacgaa
ctggcgaattacggggagtactctggtgcccccagtgaacaacagacctatgactacgcc
aagaccatcctctcacttatgactcgagagaagcacccggatggcaagatcctcatcatt
ggaggcagcattgcaaacttcaccaacgtggccgccaccttcaagggcattgtgagagca
attcgagattaccagggtcccctgaaggagcacgaggtcaccatctttgttcgaagaggt
ggcccgaactatcaagagggattacgagtgatgggagaagttgggaagaccactggaatc
cccatccatgtctttggcacagaaactcacatgacggccattgtgggcatggccctgggc
caccggcccattcccaaccagccacccacagcggctcacactgccaacttcctccttaat
gccagtgggagcacatcgacaccagcacccagcaggacagcgtctttttccgagtccaga
gctgacgaggtggcccctgcaaagaaagccaagccagccatgccccaagattcagtccca
agtccaagatccctgcaaggaaagagtgccaccctcttcagccgacataccaaggctatc
gtgtggggcatgcagacccgggctgtgcaaggcatgctggactttgactacgtgtgctcc
cgagatgagccttcagtggctgctatggtctacccgttcacgggggatcataagcagaag
ttttactggggacacaaggaaatcctgatccctgtcttcaagaacatggctgacgccatg
aaaaagcatccggaggtagacgtgctgatcaactttgcatctctgcgatcggcttatgac
agcaccatggagaccatgaactatgcacagatccggaccatagccatcatagcagaaggc
atccctgaggctctcacacggaagctcatcaagaaggcagaccagaagggcgtgaccatc
attgggccagccacggttgggggcatcaagcctggatgctttaagattgggaatactggt
gggatgctggacaacatcctggcctccaaactgtatcgcccaggcagtgtggcctacgtc
tcgcgttcaggaggcatgtctaacgaactcaataatatcatctctcggaccacagatggt
gtctacgagggtgttgccatcggcggggacaggtaccctgggtccacattcatggatcac
gtgctgcgttaccaagacactccaggagtcaagatgattgtagttcttggggagataggg
ggtacagaagaatataagatctgccggggcatcaaggagggccgcctcaccaagccagtg
gtctgctggtgcatcgggacctgtgccaccatgttctcttctgaggtccagtttggccac
gctggggcttgtgccaaccaggcttctgaaacggcagtagccaagaaccaggccttgaag
gaagcgggagtgtttgtgccccgaagctttgatgagctcggagaaatcattcagtccgtg
tatgaagatcttgtggccaaaggcgccattgtacctgctcaggaagtgccacctccaaca
gtacccatggactactcttgggccagggagctgggtttaatccgaaaacctgcctcattc
atgaccagcatctgtgacgagcgggggcaggaactcatttatgcgggcatgcccatcacc
gaggtcttcaaggaagagatgggcattggtggtgtcctgggcctcctctggttccagaga
aggttgcccaagtattcctgccagttcattgagatgtgtctcatggtcaccgctgatcac
gggccagctgtctccggggcccataacactatcatctgtgctcgggctgggaaggacctg
gtctccagcctcacctcagggctgctcaccattggggaccggtttgggggtgccttggac
gcagcagcgaagatgttcagtaaagcctttgacagcggcattattcccatggagtttgtg
aacaagatgaagaaggaggggaaactgatcatgggcatcggccatcgagtcaaatcgata
aacaacccagacatgcgagtgcagatcctcaaagactttgtcaaacagcacttccccgcc
accccgctgctcgactatgcactggaagtggagaaaatcaccacctcaaagaagccaaat
cttatcctgaacgtggatggtttcatcggcgttgcgtttgtggacatgcttaggaactgt
ggctccttcacccgggaggaagctgacgagtatgttgacattggagccctcaatggcgtc
tttgtgctgggaaggagtatgggcttcatcgggcactatcttgaccagaagaggctgaag
caagggctgtatcgtcacccctgggacgacatttcctatgttctcccggaacacatgagc
atgtaa

DBGET integrated database retrieval system