KEGG   Rattus norvegicus (rat): 24161Help
Entry
24161             CDS       T01003                                 

Gene name
Acp1
Definition
(RefSeq) acid phosphatase 1, soluble
  KO
K14394  low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00730  Thiamine metabolism
rno00740  Riboflavin metabolism
rno01100  Metabolic pathways
rno04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    24161 (Acp1)
   00740 Riboflavin metabolism
    24161 (Acp1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    24161 (Acp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24161 (Acp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     24161 (Acp1)
    3.1.3.48  protein-tyrosine-phosphatase
     24161 (Acp1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class II PTPs
   Low molecular weight PTPs (LMWPTPs)
    24161 (Acp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LMWPc TMEM206 IgG_binding_B
Motif
Other DBs
NCBI-GeneID: 24161
NCBI-ProteinID: NP_067085
RGD: 2020
Ensembl: ENSRNOG00000005260
UniProt: P41498
Position
6q16
AA seq 158 aa AA seqDB search
MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDENVSDNWRIDSAATSTYEVGNPPDYRG
QNCMKKHGIHMQHIARQITREDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTH
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggttgggtccaagtcagtgctgttcgtgtgtctcggtaacatttgccggtca
cccattgcagaagcagtgttcagaaaattggtaactgatgaaaacgtttcagataactgg
aggatagacagtgcggctacatccacctatgaagtggggaacccccctgactatcgaggg
cagaactgcatgaaaaaacatggcatccacatgcaacacattgcacggcagattacaaga
gaagactttgccacattcgattatatactgtgtatggatgaaagcaatctgagagatctg
aatagaaaaagtaatcaagttaaaaactgcaaagctaaaatcgagctacttgggagctat
gatccacagaagcagctcattattgaagatccctattatggcaatgactctgacttcgag
gtggtgtaccagcaatgccttaggtgctgcaaggccttcctggagaagactcactag

DBGET integrated database retrieval system